KEGG   Pradoshia sp. D12: F7984_03055
Entry
F7984_03055       CDS       T06218                                 

Gene name
mutY
Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
prd  Pradoshia sp. D12
Pathway
prd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    F7984_03055 (mutY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_03055 (mutY)
Enzymes [BR:prd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     F7984_03055 (mutY)
DNA repair and recombination proteins [BR:prd03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     F7984_03055 (mutY)
 Prokaryotic type
     F7984_03055 (mutY)
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH HHH_5 EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: QFK70304
UniProt: A0A5J6XLK9
LinkDB
Position
623331..624410
AA seq 359 aa
MKTLVSCNIEQFRKDLIDWFIQEQRQLPWRLNKDPYRVWVSEIMLQQTRVDTVIPYYERF
MEWFPTLDDFADADEEKYLKAWEGLGYYSRVRNLHSAVKEVKENYGGIVPNTPEEIKKLK
GVGPYTAGAILSIAYGVPEPAVDGNVMRVISRILEIYDDIAKPATRKLFDSAVRELIDTE
HTSEFNQALMELGALICVPGKPACLLCPVREHCWAFDKGIQQELPVKTKAKKTKIVHLSA
LVINDESGRILIRKRPETGLLAGLWEFPSYETTGDVKELKEMIAEQNQVELNQLTPIGHI
NHVFSHLTWEIDIYTATVNNLENFKSNTHKLAYVKDHDFQQYALPVSHQKIYETYVFNG
NT seq 1080 nt   +upstreamnt  +downstreamnt
gtgaagacacttgtaagttgcaatatagaacaattcagaaaagatcttatagattggttt
attcaggaacaaagacagctcccgtggcgattaaataaagatccctatcgtgtctgggtt
tctgaaattatgcttcagcaaacccgtgtggataccgttattccttattacgaacgtttt
atggaatggtttccgacacttgatgattttgctgatgctgatgaggaaaaatatttaaaa
gcatgggaaggtctaggctactattctcgggttcgtaatttgcatagtgcagttaaagag
gtaaaggaaaactacggtggaattgtgccaaacactcctgaagaaattaaaaaattaaaa
ggtgtcggtccatacactgccggtgcgatattaagcattgcttatggtgttccggagcct
gcagttgatggaaatgtcatgagagtcatttccaggatattagaaatatatgatgacata
gcgaagcctgccacccgcaaactatttgattcagctgtacgtgaattaattgataccgaa
catacgtcagaatttaatcaggcattgatggaacttggcgctcttatatgtgttcctggt
aaacctgcatgcttattatgtccggtaagagagcactgctgggcatttgataaaggaatc
cagcaggagcttccggtaaaaactaaagctaaaaagaccaaaattgttcatttatcggca
cttgtgataaacgatgaaagtggaagaatcctgattaggaagcggccggagacaggtctt
ctcgcagggttgtgggaattcccaagctatgaaacaacaggagatgtgaaagaacttaaa
gaaatgattgcggaacagaatcaagttgaattaaatcaattaactccaatcggtcatatc
aatcatgtattttcacatttgacatgggaaattgatatctatacagccactgtgaataat
ttggagaactttaaaagcaatacacataaattagcatatgtgaaagatcatgattttcaa
cagtatgctttacctgtatctcatcaaaaaatttatgaaacatatgtatttaatggttaa

DBGET integrated database retrieval system