KEGG   Pradoshia sp. D12: F7984_06370
Entry
F7984_06370       CDS       T06218                                 

Gene name
murG
Definition
(GenBank) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
prd  Pradoshia sp. D12
Pathway
prd00550  Peptidoglycan biosynthesis
prd01100  Metabolic pathways
prd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F7984_06370 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    F7984_06370 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prd01011]
    F7984_06370 (murG)
Enzymes [BR:prd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     F7984_06370 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:prd01011]
 Precursor biosynthesis
  Glycosyltransferase
   F7984_06370 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glycos_transf_1 UDPGT Glyco_transf_4 CmcI Glyco_trans_4_2 Glyco_trans_4_4
Other DBs
NCBI-ProteinID: QFK70896
UniProt: A0A5J6XME2
LinkDB
Position
1289319..1290407
AA seq 362 aa
MKIVLSGGGTGGHIYPALAMAREIKKLNPEASFLYIGTEKGLEKDLVSREGLDFKAIEIT
GFKRSLSLENVKTIWRFLKGVSNSKKLLKEFKPDVVIGTGGYVCGPVVYAASKMKIPTII
HEQNSVPGLTNKFLSRYVNKVAISFEEARQYFPKEKVVFTGNPRGSEVVSHIGSNAIQQL
GIKKGIPSVLIFGGSRGAKAINEAVLKNVEVLKDKPYQVIYITGDVHYQSVKEELDLVGT
PDNVIVKPFIHNMPEILPSVDLVVSRAGATTLAELTALGIASILIPSPYVTNNHQEKNAQ
ALVQKGAATMIKESELNGSTLIKAIDEIMLDTDRIESMKKSAKQMGIPDSAERLLKMMQD
LQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgaaaatagtattaagtggtggaggtacaggaggacatatataccctgcactggccatg
gcaagagaaattaagaagttaaatccggaggcatcttttttatatataggtaccgaaaaa
ggattagaaaaagacctcgttagtcgagaaggtcttgattttaaagctattgagattaca
ggatttaaacgatctttaagcttagaaaatgttaaaacaatatggcgcttcttaaaaggt
gtttcaaacagcaaaaaactattaaaagagtttaagccggatgtcgtcatcgggaccggt
ggatatgtatgtggaccggttgtttatgcagcgtccaaaatgaagattccaacgattata
catgaacaaaatagtgtgccaggtttaacaaataaatttttaagtcgatatgttaataaa
gtggctataagctttgaagaggctcggcaatatttcccgaaggaaaaagtggtctttact
ggaaatccgaggggctcagaggttgtatcacatattggctcaaatgcaattcagcaattg
ggcattaagaaaggcattccttctgtgctcatattcggaggaagccgcggagcaaaagca
attaatgaagctgttttaaaaaatgttgaagtattaaaggataaaccataccaagtgata
tatataactggtgacgttcattatcaatctgtaaaagaagagcttgatttagttggaact
ccagataatgtcattgtaaaaccatttatacacaatatgccggaaatattgccttcggtt
gatttggttgtatcgcgagcgggagcgaccactttggctgaattaacagcattgggaata
gccagtatcttgattccaagtccttatgtaacgaataatcatcaggaaaagaatgcacag
gctttagtacaaaaaggggcagcaaccatgataaaagaaagtgaattgaatggtagcacc
ttaattaaagcgattgatgaaataatgctcgatacagacaggattgaatctatgaagaag
tcagcgaagcaaatgggtatacctgattcggctgagcgtttattaaaaatgatgcaggat
ctgcagtaa

DBGET integrated database retrieval system