KEGG   Pradoshia sp. D12: F7984_08255
Entry
F7984_08255       CDS       T06218                                 

Gene name
mutL
Definition
(GenBank) DNA mismatch repair endonuclease MutL
  KO
K03572  DNA mismatch repair protein MutL
Organism
prd  Pradoshia sp. D12
Pathway
prd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    F7984_08255 (mutL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_08255 (mutL)
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Molecular matchmaker
     F7984_08255 (mutL)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c DUF1357
Other DBs
NCBI-ProteinID: QFK71237
UniProt: A0A5J6XMA2
LinkDB
Position
1698527..1700458
AA seq 643 aa
MGKIVLLDDLLSNKIAAGEVVERPASVVKELVENSIDANSTVIEIYATEAGLESIRIIDN
GEGMEEDDALNAFHRHATSKIKDENDLFRIRTLGFRGEALPSIASVSKFELKTSTGDGPG
TRLLLEGGKVLTHESYSSRKGTDITVSELFFNTPARLKYVKSVHTELGNITDVVNRLALS
HPDVSFKLVHNDRTLLQTSGNGNPLQVLAGIYGIQTAQKMLPFEASTLDFSIKGYAGHPE
MTRASRNYMTILVNGRFIKNYLIAKAVMEGYHTLLPIGRYPIAMLNIEMDPLLVDVNVHP
SKMEVRFSKEQELMTLISEAIRNTFKKETLIPTGAPVKREEKAKMEQAQFTFTEERAKRP
EAPKQTPPMVKATEGFSVIYDPPEIEQPKREFEAPSPIELNEPGRESVEEQVETEPFISS
EAGSERVGTIVEQKEEELEPIQDNQDMQESRIPPLYPIGQLHGTYILAQNEQGLYMIDQH
AAQERIKYEFFKHKVGEVNKELQEMLVPMTLEYSTDEFVKLEEHKEELEAVGVFLEPFGL
NSYIVRAHPTWFPAGMEETIIDEMVHQVLTMKKVDIKKLREEAAIMMSCKGSIKANRHLR
NDEISALLDELRHTNDPFTCPHGRPIIVHYSIYELEKMFKRVM
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggggaaaattgtactgttagatgatctattatccaataaaatcgctgccggagaagta
gtagagagacctgcatctgttgtaaaagagttagtggaaaactcaatagatgctaacagt
acggtaattgagatttatgctacggaagccggtcttgaatccattcgcattattgataat
ggggaagggatggaagaggacgatgccctcaatgcttttcacaggcacgcgaccagtaaa
ataaaggacgaaaacgatttattcagaattcgtacgctaggtttccggggtgaggcattg
ccttcaatcgcttctgtttccaaattcgaattaaagacctcaacaggtgatggacctgga
acccgtcttttactcgagggcggcaaggtccttactcatgagtcctattcaagccgtaaa
ggaaccgatataacggtgagtgaactgttctttaatacaccggctcgtctgaaatatgtt
aaaagcgttcatacagagcttgggaatataaccgatgtcgtaaataggctggcactgtcg
catccggatgtatcgtttaagctggttcacaacgaccgtaccttattacaaacatcaggc
aacggcaatccacttcaggtgcttgccgggatatatgggatacaaactgctcaaaaaatg
ctgccgtttgaagcatcaacacttgatttttcaataaaaggctatgccggacatccggaa
atgacgagggcttcgcgtaactatatgaccattttggtaaatggaagatttattaagaat
tatttgatcgccaaagcagtcatggaagggtaccatactttattgcctattggacgttat
ccaattgcgatgctcaatattgaaatggatcctttattggttgatgtgaatgtgcatcct
tccaaaatggaggttcgtttcagtaaagagcaagagctgatgacattaattagcgaggcc
atccggaatacgtttaaaaaagagacattaattccgacaggcgctcctgttaaacgtgag
gaaaaagcaaaaatggaacaagctcaatttacgtttacggaggaaagagccaagcggcct
gaggcgccaaagcagactcctccaatggtaaaggcaactgaaggattttcagtgatttat
gatccgcctgagattgaacagccgaagcgggaattcgaggctcctagtcctatcgagttg
aacgagcctggaagggaatcagtagaagaacaggtagaaactgaaccgtttatcagttca
gaagcgggttccgaacgtgtcggaacgatcgtagagcaaaaagaagaggaattagagccg
attcaagacaatcaggacatgcaagaaagccgaattccgcctttatatccgattggacag
ctgcatggaacgtatattttggcccaaaatgaacaagggctctatatgattgaccagcat
gctgcccaagagcggattaagtatgagttcttcaagcataaggtgggagaggtcaacaaa
gaactgcaagaaatgttggtaccgatgacactggagtattcaacagatgagtttgtgaag
ctggaagaacataaagaagagctggaagcggtcggagtatttttagaaccatttggatta
aatagttatattgtccgcgcccatccaacctggttcccagcaggcatggaagaaacgatc
atcgatgaaatggtccaccaagtattaacgatgaaaaaggtggatatcaagaaattgcgt
gaggaagcggcaattatgatgagctgtaaggggtcaattaaagccaaccggcatttgcgt
aatgatgaaatcagtgcattactggatgaattgcgtcatacaaatgatccattcacatgc
ccgcatggccgtccaattatcgttcattattcgatttatgagctggagaaaatgtttaaa
cgggttatgtaa

DBGET integrated database retrieval system