KEGG   Pradoshia sp. D12: F7984_09940
Entry
F7984_09940       CDS       T06218                                 

Gene name
xth
Definition
(GenBank) exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
prd  Pradoshia sp. D12
Pathway
prd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    F7984_09940 (xth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_09940 (xth)
Enzymes [BR:prd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     F7984_09940 (xth)
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     F7984_09940 (xth)
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Other DBs
NCBI-ProteinID: QFK71530
UniProt: A0A5J6XPH5
LinkDB
Position
complement(2072009..2072764)
AA seq 251 aa
MKFVSWNVNGIRACVGKGFLDTFKELNADIFCLQETKLQEGQINLELDGYYQYWNYAVKK
GYSGTAIFTRQKPLSVKYGIGNDEYDVEGRAITLEFDQFFIVNVYTPNSQRDLARLGYRL
VWEDLLYAYLHELNKEKAVILTGDLNVAHKPEDLRNPKSNKGNSGFTDEERGKMTALLSS
GFVDSFRYLYPDKTEVYSWWSYMSKVRERNIGWRIDYFIVSESIANLITEAEIHTSIMGS
DHCPISLEMKI
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaaatttgtttcttggaatgtgaatgggataagagcttgcgttggaaaaggttttttg
gatacttttaaagaattaaacgctgatatattttgtttgcaggaaactaaactgcaggag
ggccagattaatctggagctggatggctattatcaatactggaattacgctgtaaaaaaa
ggatactcaggcacggcaatttttactcgtcaaaaaccattatccgttaaatacgggatt
gggaatgatgagtatgatgtggaaggcagagccattacattggaatttgatcaatttttc
attgtaaatgtgtatacaccaaattcacagcgtgacctggcaaggcttgggtaccgtttg
gtttgggaagatttactttatgcttacttacatgaattgaataaagagaaagcagtgatt
ttaacgggagatttaaatgttgctcataaacccgaagatttacgaaaccccaaatcaaat
aaagggaattctggcttcacagatgaggaacgaggtaagatgacagctttattatctagc
ggttttgttgattccttccgttatctctatcctgataaaacagaagtgtatagctggtgg
tcttatatgagcaaagtccgcgaacgtaatattgggtggcggattgactactttattgtg
tctgaatcaatcgctaatctaattaccgaagcagaaatccacacgtcaattatgggtagt
gaccattgtccaatttctttggaaatgaaaatttga

DBGET integrated database retrieval system