KEGG   Pradoshia sp. D12: F7984_09995
Entry
F7984_09995       CDS       T06218                                 

Definition
(GenBank) ribonucleoside-diphosphate reductase subunit alpha
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
prd  Pradoshia sp. D12
Pathway
prd00230  Purine metabolism
prd00240  Pyrimidine metabolism
prd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    F7984_09995
   00240 Pyrimidine metabolism
    F7984_09995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_09995
Enzymes [BR:prd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     F7984_09995
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    F7984_09995
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN RNR_N
Other DBs
NCBI-ProteinID: QFK71540
UniProt: A0A5J6XPI3
LinkDB
Position
complement(2081814..2084078)
AA seq 754 aa
MAVSYESNYASLEVINLKSIETYIKECVSSYTSIYSAEEYLEKIKTALEYKSDYSKKELV
NLLVLSAVERISADEPDWTFVAATIYLDQLYDKASKSRGYDLTHKYGSFHQLVELLTDMG
IYNPALLNEYTEDEINELEAVIDSSKDQLFTYIGIRTLADRYLAKSHHGSLYELPQERFM
IIAMTLMMNEPKEQRIKLIREAYWALSNLYMTVATPTLANAGKSYGQLSSCFIDTVDDSL
QGIYDSNTDIANLSKNGGGIGVYLGKIRARGSDIKGFKGVSSGVIPWMKQLNNTAVSVDQ
LGQRQGAIAVYLDVWHKDIFAFLEARLNNGDERFRTHDLFTGVCIPDLFMEMVKERGTWY
LFDPHEVRKVMGYSLEDYFDEEAGDGQFRQKYTECINHPQLSKKEIPAIEVFKAIMISQL
ETGTPYMFYRDTVNRSNANRHKGMIYCSNLCTEIMQNQSATKVIEQRTEDGKIIIEKTPG
DFVVCNLSSISLAKAVKEDVLERLIKIQVRMLDNVIDLNNIPVIQANITNKNYRAIGLGT
FGWHHLLALEGIAWESEKAVEYCDRLYEKIAYLTIKSSVDLAGEKGAYPFFEGSDWETGS
YFDQRGYDSDAWSQLKNRVHTSGIRNGYLMAVAPNSSTAIIAGSTSGIDPIFRREYSEEK
KNYRIPVTAPDLNLETMWYYKSVYLIDQKWSILQNARRQKHIDQGISFNLYVRNDIKARD
LLDLHLLAWETGLKTTYYVRSTSSAVIEECESCQ
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggcagtatcttacgaatcaaactatgcaagtctggaagtcataaatttaaaaagcata
gaaacatacataaaggaatgtgttagttcctatacatctatttattcagcagaggaatac
ttagaaaaaatcaagacagcacttgagtataagtctgactatagcaagaaagagttggtg
aatttactggtactaagcgccgtagagcgtatctctgctgatgagcctgattggacattt
gtggcggcaactatttatttagaccagttatatgataaagcttcaaaaagccggggatat
gatttaacacacaaatatgggagctttcatcagcttgttgaactattgactgatatgggg
atttataatccagcattgttaaatgaatatacggaagacgaaatcaatgaactcgaagca
gtcatcgattcatcaaaagatcagttgtttacgtatattggcattcggacgctggcagat
cgctatttagccaaatctcatcatggaagcttatatgaacttcctcaggaacggtttatg
attattgccatgacattaatgatgaatgagcctaaagaacagcgaatcaaattaataaga
gaagcatattgggccttatccaatctatatatgacggtggcaactcctacgcttgctaat
gctgggaaaagctatggccaattatccagttgttttatcgatactgttgatgatagtttg
caaggtatctatgattcaaacaccgatattgccaatctatctaaaaatggcggaggaata
ggtgtttatttagggaaaattagagcgcgaggcagtgatattaaaggatttaagggtgtt
tcctcaggagttataccatggatgaagcaattaaataataccgccgtcagtgtggaccaa
ctgggccaaagacagggtgccattgcagtttatctggatgtttggcataaggatatattt
gccttcctcgaagcgcgtttaaataatggggatgaacgttttcgaacgcatgatttattt
actggtgtttgcattccggatttatttatggaaatggtcaaggagcggggtacctggtat
ttatttgatccgcatgaagtaagaaaagtaatgggatattctcttgaagattattttgat
gaagaagcaggggatggccaattcagacaaaaatatactgaatgtatcaatcatccgcag
ctttccaaaaaagaaatacctgccattgaagtgtttaaggcgatcatgatttctcagctt
gaaacaggaacaccttatatgttttatcgggatacggtcaaccgctctaatgctaatcgc
cataaaggaatgatatattgcagtaatttatgtacggaaattatgcaaaatcaaagtgct
accaaagttattgaacaaagaaccgaggatgggaaaattattattgaaaaaacaccgggt
gactttgttgtatgtaatctttcgtctatctcccttgccaaagctgtaaaggaagatgtc
cttgaacgcttaattaagatacaggtgagaatgcttgataatgtcattgatttaaataat
atcccggtcattcaggcaaatataacgaataaaaattatcgtgctataggacttgggaca
tttggctggcatcatttattagcgcttgagggcattgcctgggaatcagagaaagccgtt
gaatactgtgaccgattatacgaaaaaatcgcttatttaacgattaaatcaagtgtggat
ttagctggtgaaaaaggtgcttacccattttttgaaggatctgattgggagaccggatct
tattttgaccaaagaggctatgattcagatgcttggagtcaattgaaaaatagagtgcat
acatccggaattcgaaatggctatcttatggccgtagcaccaaattcttcaactgcgatt
attgccggttctacatccggaattgatccaattttcagaagggaatattccgaagagaag
aagaattaccgtattccagtgactgcacctgacttgaatctggagacaatgtggtattat
aaatccgtttatttaattgaccaaaaatggagcattctccaaaatgcacgtcgtcaaaaa
catatcgaccaaggaatctcgtttaatttgtatgtccgtaatgatattaaagcacgtgat
ttattagacttgcatctgcttgcatgggagaccggattaaaaacaacatactatgtacgt
tctacttcaagcgctgttatagaagaatgcgaaagctgccaataa

DBGET integrated database retrieval system