KEGG   Pradoshia sp. D12: F7984_10290
Entry
F7984_10290       CDS       T06218                                 

Definition
(GenBank) mismatch-specific DNA-glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
prd  Pradoshia sp. D12
Pathway
prd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    F7984_10290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_10290
Enzymes [BR:prd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     F7984_10290
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     F7984_10290
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: QFK71592
UniProt: A0A5J6XMK9
LinkDB
Position
complement(2151466..2152017)
AA seq 183 aa
MEDFESLTLPTYIKPGLDIVFCGINPGRISALKGYHFANPANLFWKGLYLGGITPYQFKP
EETAKLLDYGYGITDIVGRATRSSSDLKKDEFIEGAADLRNLITQYKPKCLCFIGITAFR
YATNRLKGKVEPGLQDGLFFATPDWEGCYIFVVPSTSGVNAHYTREERIDYFRQLYEWNK
SQK
NT seq 552 nt   +upstreamnt  +downstreamnt
atggaggattttgaatctttaacattgccaacctatatcaagcctggattggatattgta
ttttgtgggattaatcctggcagaatttctgctctaaaagggtatcattttgcgaatcca
gcgaatttgttttggaagggtttgtatttgggtggcattacgccgtatcagtttaaacct
gaggagacggcaaagctcttggactatggttacggaataactgatattgtcggcagggca
acaagatcttcttctgatttgaaaaaagatgaatttatagagggtgcggctgacctaagg
aatttaatcactcaatacaagcctaaatgtttatgcttcattgggattactgccttccgc
tatgcaacaaaccgtcttaaaggcaaagtagaaccaggtcttcaggacggcttgtttttt
gctacacctgattgggaaggctgctatatctttgttgttccatctacaagcggggtaaat
gcccattatacgagagaagaacgaatagactatttccggcaattatatgagtggaataaa
tctcaaaaataa

DBGET integrated database retrieval system