KEGG   Pradoshia sp. D12: F7984_11325
Entry
F7984_11325       CDS       T06218                                 

Gene name
nth
Definition
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
prd  Pradoshia sp. D12
Pathway
prd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    F7984_11325 (nth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_11325 (nth)
Enzymes [BR:prd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     F7984_11325 (nth)
DNA repair and recombination proteins [BR:prd03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     F7984_11325 (nth)
 Prokaryotic type
     F7984_11325 (nth)
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S HHH_5
Other DBs
NCBI-ProteinID: QFK71775
UniProt: A0A5J6XNF1
LinkDB
Position
complement(2368325..2368984)
AA seq 219 aa
MLTNTQIRYCLDEMARMFPEAHCELNHSNPFELTVAVVLSAQCTDALVNKVTKNLFQKYK
KPEDFLSVPLSELENDIRSIGLYRNKAKNIQKLSQIILEKYNGVVPNDRDLLVELPGVGR
KTANVVVSVAYGTPAIAVDTHVERVSKRLGICRWKDSVLEVEKTLMRRIPEEEWSITHHR
LIFFGRYHCKAQSPKCEECPMLLLCREGKKRMKAAGKGK
NT seq 660 nt   +upstreamnt  +downstreamnt
atgcttaccaatacacaaattcgttattgtctcgacgaaatggcaagaatgtttcctgag
gcccattgcgaattaaatcattccaatccattcgaattaaccgtggcggtagtattatcg
gcacaatgtacggatgctttggtgaataaagtaacgaaaaatctctttcaaaaatataaa
aaaccagaggatttcctttctgtaccgcttagtgaattggaaaatgatattcgttcaatt
ggtttatacagaaataaagcgaaaaatattcagaagttatcgcagattattctggaaaaa
tacaatggggtagttccgaatgaccgggatttattagttgagcttcccggagtagggaga
aagacagcgaatgtggttgtttcagtagcgtatggaacacctgcaatcgctgtggataca
cacgtggagagagtaagtaaaaggcttggtatatgcaggtggaaggactccgtcttagag
gttgaaaaaacgctgatgagaagaatcccagaggaagaatggtcgattacccatcaccga
ttaattttctttggtagataccattgcaaagctcaatcgccaaaatgtgaggagtgtcct
atgcttctactgtgccgtgaagggaaaaaaagaatgaaagcagcaggaaaaggaaaatga

DBGET integrated database retrieval system