KEGG   Pradoshia sp. D12: F7984_15090
Entry
F7984_15090       CDS       T06218                                 

Definition
(GenBank) Replication initiation and membrane attachment protein
  KO
K03346  replication initiation and membrane attachment protein
Organism
prd  Pradoshia sp. D12
Brite
KEGG Orthology (KO) [BR:prd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:prd03032]
    F7984_15090
DNA replication proteins [BR:prd03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    F7984_15090
SSDB
Motif
Pfam: DnaB_2
Other DBs
NCBI-ProteinID: QFK72474
UniProt: A0A5J6XTG7
LinkDB
Position
complement(3143036..3144412)
AA seq 458 aa
MQFSWKFVNPKDRYVVLYKEKLSEMDHKSIQYLYQPLVGGLAVSLYMTLLNEVNTGNMYS
RQTTHRWLMDVLGLPLDEIFQYRKRLEGIGLLKTYKKATPEGNVFIYEILCPLSPDKFFH
DDLLPIYLKQKLEERHYERLLTMFADKRIPDDYEEITQSFNEVFASEFRNPKEIISSETD
QNMQFFSKDPQGYSHNLMEQFDFELLFATAKNSFISRKAFTPNVMESIAMLSYLYKINVM
DMSKLILRCQNQHNEIDIDELRKCAREFFHINHGEEMPTLIEQKQPEYERTIIEPKTPEE
HLLYTFETTSPLEFLVSLSQGAMPSDNDLALVEKVMVNQKLPPGVVNVLLHYVMLKSDMK
LQSNYVETIASHWARKNITTVREAYEMALSEHKKYQTWANEKKTKTNKSTRRTSGNARKE
IVPDWLDETKKKEPVAQSTEIAERVRKLKEKLQNENSK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgcaattttcatggaagtttgtaaatcctaaagacagatatgttgtactatataaagaa
aagctatcagaaatggaccataaatcgattcaatatttatatcagccacttgtaggagga
ttggctgtttctttgtatatgaccttattaaacgaagtcaatacaggtaacatgtattcc
agacaaacgacacatcgttggttaatggatgtacttggtttacctttggatgagatattt
caataccgaaaaaggcttgaaggaatcgggttattaaaaacatataaaaaagcaactccg
gaaggtaatgtttttatatatgagattctttgtcctttaagtccggataaatttttccat
gatgatttgctgcctatttatctgaagcaaaaactagaagagagacattacgaacggctg
ctcacgatgtttgcggataaacgtataccggatgattatgaggaaataacacaatcgttc
aatgaggtgtttgcatctgaatttcgcaatccaaaagaaatcatcagctcggaaactgat
caaaacatgcaattcttctcaaaggacccacagggatatagccataatttaatggagcaa
tttgatttcgagttattatttgcgacggctaaaaacagctttatatcgagaaaagcgttt
actccaaatgtgatggaatccatcgcgatgctatcgtatttatataaaattaatgtaatg
gatatgagcaagttgattttacgctgtcaaaatcaacataatgaaattgatatagacgaa
ctcagaaaatgtgcaagagagtttttccacatcaatcatggtgaagaaatgccgacactg
attgaacagaaacagcctgagtatgaacgtacgatcatagaacctaaaacacccgaggag
catttgctgtatacttttgaaacaacctctccgttggaatttctagttagcctttcgcaa
ggcgcaatgccttccgacaatgatctggcacttgtagaaaaggtcatggtcaatcaaaag
cttcctcctggagtcgttaatgtccttctgcactatgtcatgttaaaatcagatatgaaa
ttgcaatcaaactatgtggagacaattgcttcgcactgggcgaggaaaaatatcaccacc
gtccgtgaagcctatgaaatggctttgagtgagcataagaaataccaaacctgggctaat
gagaaaaagacgaaaacaaataaatcaacacgccgcacatcgggtaatgcgaggaaggaa
atcgttcctgactggctggatgaaacaaagaagaaagagccagttgctcaatccaccgaa
attgctgagcgggtaagaaaactcaaggaaaaattgcaaaatgaaaattctaaataa

DBGET integrated database retrieval system