KEGG   Pradoshia sp. D12: F7984_15125
Entry
F7984_15125       CDS       T06218                                 

Gene name
polA
Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
prd  Pradoshia sp. D12
Pathway
prd03030  DNA replication
prd03410  Base excision repair
prd03420  Nucleotide excision repair
prd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    F7984_15125 (polA)
   03410 Base excision repair
    F7984_15125 (polA)
   03420 Nucleotide excision repair
    F7984_15125 (polA)
   03440 Homologous recombination
    F7984_15125 (polA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:prd03032]
    F7984_15125 (polA)
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_15125 (polA)
Enzymes [BR:prd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     F7984_15125 (polA)
DNA replication proteins [BR:prd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     F7984_15125 (polA)
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     F7984_15125 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     F7984_15125 (polA)
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc HHH_5 HHH_2
Other DBs
NCBI-ProteinID: QFK72481
UniProt: A0A5J6XT64
LinkDB
Position
complement(3149264..3151891)
AA seq 875 aa
MKKKLILIDGNSIAYRAFFALPLLNNEKGVHTNAIYGFAMMLNKIISEENPTHILVAFDA
GKTTFRHSTYKEYKGGRQKTPPELSEQFPFIRELLDAYGISRYELTNYEADDIIGTLALE
AEKGDYEVQIISGDKDLTQLATDKTTVRITRKGITDMEDYTPEHIREKYNLMPNQIIDLK
GLMGDASDNIPGIPGVGEKTALKLLNQFGTVEKVVASPDEISGKKLKEKVEEFKDQAILS
KQLATIETNAPIEVELESIDYAGADQEKLLSIYRELGFATLIEKMEPAAKEEMAVLEEID
YKAVEEVTEDMLTAESSLYLELLDPNYHTAKVIGIAISNENGTFFIDKDKAAGSPLFKEW
AENPEYKKTVYDAKQSIVALSHDGIALKGIEFDVYLASYVLNPAEPDVDMADLAKKHNAG
HIQTDESFYGKGAKRSIPPVAELGEHIARKALSLTLIKESLERQLEEFNQIGLLQDLELP
LALILAEMEITGVKVDENRLKEMGAELAGRLKDIEAKIYDMAGESFNINSPKQLGVILFE
KLNLPIIKKTKTGYSTSADILEKLESKHSIVREILHYRQLGKLQSTYIEGLLKVIHDDQK
VHTRFNQALTQTGRLSSTDPNLQNIPIRLEEGKKIRQAFVPSEEGWVIFAADYSQIELRV
LAHIAGDENLIDAFNSDMDIHTRTAMDVFHVDADQVTSNMRRQAKAVNFGIVYGISDYGL
SQSLGITRKEAGIFIDRYLESFPGVQQYMKDIVEEAKENGYVSTLLQRRRYIPEINNRNF
NVRGFAERTAMNTPIQGSAADIIKLAMIRMNARLKKENLQTRMLLQVHDELIFEAPPEEL
DILKKIVPEEMENAIELAVPLKVDYSFGNTWYDAK
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgaagaaaaaattgattttaatcgatggaaacagcattgcctatcgggcgttttttgca
ttgccattactgaataacgagaagggtgtacacacaaatgccatctatggttttgcgatg
atgctcaacaaaatcatttcagaggaaaatcctactcatatattagttgcttttgatgcc
gggaaaacaacgttcagacacagtacatataaagaatacaaaggcggacgtcaaaagacg
ccacctgaattatcagagcaatttccttttattcgagaattactggatgcatacggaatc
tctcgctatgagttaacgaattatgaagccgacgatattatcggaacacttgctcttgaa
gctgaaaaaggggattatgaagtacaaattatctccggcgataaagatttaacccagctt
gctacggataaaacgactgtacgtattacccgtaaagggattacggatatggaggattat
acaccggagcatattcgtgaaaagtataacttaatgccgaatcaaatcattgatttaaaa
ggattaatgggggatgcttcagataatattcctggaatcccgggtgtaggtgagaaaact
gccttaaaattgttgaatcaatttggaacagttgagaaggtagtggcttcccctgatgaa
atcagcggaaaaaaactaaaagaaaaagtggaagaattcaaggaccaagctattttaagt
aagcagttggcaacaattgaaacaaatgctccaattgaggtagagcttgaatcaattgat
tatgcgggtgcagaccaggaaaagctgctgtctatctatagggagcttggatttgcaacc
ttaattgaaaaaatggaaccagctgcaaaagaagagatggccgtccttgaagagattgac
tataaggcagtggaagaagtgacggaagatatgctgacagcagagtcctcactctatcta
gaactgcttgatccgaattatcatactgcaaaagtaattggcatagctatttcaaatgaa
aatggaacattctttatcgataaggacaaggctgcaggatcccctcttttcaaagagtgg
gcagagaatcctgaatataaaaaaacagtgtatgatgccaaacaaagtattgtggcatta
agccatgatgggattgctttaaaaggaattgaatttgatgtttatctggcatcctatgtt
ttaaatccagctgaaccggatgttgatatggcggatcttgctaaaaaacataatgccgga
catattcaaacagatgagagtttttatggaaaaggagcgaaacgttcaattccgccggtt
gctgaattgggtgagcatattgcccggaaagctttatcgttaacactgattaaggaaagc
ctggaaagacagctggaggaattcaatcaaataggattgctgcaggatctagaactgccg
cttgctcttatcctggctgaaatggaaattacgggtgtgaaggtcgatgagaaccgtttg
aaagaaatgggagctgaacttgcaggcagattaaaggacatcgaagctaaaatttatgat
atggccggtgaatcctttaatattaattcaccgaagcagcttggagttatcctgtttgaa
aaattaaatttacctattattaaaaagacgaagacaggctattccacatcagcagatata
cttgaaaaattagagagcaagcatagtattgtccgggaaattcttcattatagacagctg
gggaaattgcaatcaacctatattgagggacttttaaaagttatacatgatgatcagaag
gttcatacgaggttcaatcaggcattaactcaaactggacgacttagttcaacagaccct
aacctgcaaaatattccgatcagacttgaagaaggcaaaaaaatcagacaggctttcgtt
ccatctgaagaaggctgggtcatttttgcggctgattattctcaaattgaactgcgtgtt
ctggcccatatagcgggagatgaaaacctgatagatgcctttaactcagatatggacatc
cacacaagaacggctatggatgtatttcatgtggatgctgatcaggtgacatcaaatatg
agaagacaggctaaagcggtgaactttggaattgtgtatggtatcagtgattatggacta
tcgcaaagtcttggaattaccagaaaagaagctggaatctttattgatcgctatttagag
agcttccctggtgttcagcaatacatgaaggatattgtagaagaggcgaaggaaaatgga
tatgtaagtactttattgcagcgccgaagatatatacctgaaattaataatcggaacttc
aatgttcgtggttttgcagaaagaacagctatgaatacaccaattcagggcagtgctgca
gatattatcaaattggcgatgattcgaatgaatgccagattaaagaaagaaaatttacag
actagaatgctgcttcaggtgcacgatgaattgatttttgaggcgccacctgaagagttg
gatatattaaagaaaattgttccggaagaaatggaaaatgcaattgaattagcggttcca
ttaaaagtggactattcttttggcaacacctggtatgatgctaaatag

DBGET integrated database retrieval system