KEGG   Pradoshia sp. D12: F7984_15185
Entry
F7984_15185       CDS       T06218                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
prd  Pradoshia sp. D12
Pathway
prd00061  Fatty acid biosynthesis
prd00620  Pyruvate metabolism
prd00640  Propanoate metabolism
prd01100  Metabolic pathways
prd01110  Biosynthesis of secondary metabolites
prd01120  Microbial metabolism in diverse environments
prd01200  Carbon metabolism
prd01212  Fatty acid metabolism
Module
prd_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F7984_15185
   00640 Propanoate metabolism
    F7984_15185
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    F7984_15185
Enzymes [BR:prd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     F7984_15185
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     F7984_15185
SSDB
Motif
Pfam: Carboxyl_trans zf-ACC zf-NADH-PPase zinc_ribbon_2 Zn_Tnp_IS91 TF_Zn_Ribbon
Other DBs
NCBI-ProteinID: QFK72493
UniProt: A0A5J6XRQ3
LinkDB
Position
complement(3165022..3165885)
AA seq 287 aa
MLKDMFSRTKKKKYATIPSDKANQDVPEGIMMKCPSCKTIKYSKEILKNDKVCPKCGYHH
PMSAVERLSNLMDKGSFEEYDRGMISENPLNFPDYTEKLDRDRNKTKQNEAVVTGIGRIS
GHTTVIAVMDSTFRMGSMGSVVGEKITRAIEKADELKVPFIIFTASGGARMQEGVISLMQ
MAKTSAALKRFSEHSGLIISVMTHPTTGGVSASFASLGDYNLAEPKALIGFAGRRIIEQT
IHEKLPEDFQTAEFLLKHGQLDAVVPRNKMKDTLAAIIDIHTSGGSK
NT seq 864 nt   +upstreamnt  +downstreamnt
ttgttgaaagacatgttttctcgtacaaaaaagaaaaagtatgcaaccattccttctgat
aaagcaaatcaagatgtgcctgaaggaattatgatgaaatgtccgtcttgtaaaactatt
aaatactctaaagaaatattaaaaaatgataaagtttgtcctaaatgtggttatcaccac
ccgatgagtgcagttgaacgtttaagcaatttaatggataaagggtcttttgaggagtac
gatcgggggatgatatcggaaaatccactgaactttcccgattatacagaaaagctcgat
agagatcgaaataagacaaaacaaaatgaagctgtagtaacaggaataggtcgaattagt
ggtcataccactgtgattgctgtaatggattctacatttcgtatgggcagtatgggctct
gtagttggtgaaaagataacccgggccattgaaaaagctgatgaattaaaggtacctttt
attatatttaccgcatccggaggagccagaatgcaagagggagttataagtctcatgcaa
atggcaaaaacaagtgcagccttaaaacgtttcagtgagcatagcggtttgattatatcg
gttatgactcatccaactaccggtggggtatcagcgagttttgcttctctcggagattat
aaccttgcagaacctaaagctttaattggatttgccggccgtcgaataatcgagcaaaca
atccatgaaaagttaccggaagattttcaaactgctgaattccttctaaaacatggtcaa
ctggatgcagtagtgccgagaaataaaatgaaagatacactggctgcaattatcgatatt
catacatcaggggggagtaaataa

DBGET integrated database retrieval system