KEGG   Pradoshia sp. D12: F7984_15215
Entry
F7984_15215       CDS       T06218                                 

Definition
(GenBank) bifunctional oligoribonuclease/PAP phosphatase NrnA
  KO
K06881  bifunctional oligoribonuclease and PAP phosphatase NrnA [EC:3.1.3.7 3.1.13.3]
Organism
prd  Pradoshia sp. D12
Pathway
prd00920  Sulfur metabolism
prd01100  Metabolic pathways
prd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    F7984_15215
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_15215
Enzymes [BR:prd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     F7984_15215
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.3  oligonucleotidase
     F7984_15215
DNA repair and recombination proteins [BR:prd03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Others
    F7984_15215
SSDB
Motif
Pfam: DHHA1 DHH Asp_protease_2 gag-asp_proteas
Other DBs
NCBI-ProteinID: QFK72499
UniProt: A0A5J6XTR0
LinkDB
Position
complement(3172660..3173607)
AA seq 315 aa
MKEQIIDAIKKYNTIILHRHVRPDPDAYGSQCGLGEIIKYSFPEKQVFMVGQEEESLHFL
KRLDVIPDEAYEGALVIVCDTANQERVCDQRYTRGDLLIKIDHHPNEDPYGDFLWVDTSA
SSCSEMIYELYEYGKDKGLRMNQEAARLLYAGIVGDTGRFLYPSTTDKTFLYAGELIQYG
FNRTDIYDGMYDVDEAVVRLNGYVFENFKIIDSGVGVVVITKEVMERFGVKSSGASSLVS
TLGSVKGIKAWVFFIEENDEIRVRLRSKGPVINGVAMKYNGGGHPLASGATIYNWEDMNN
VLADLVQVCSNYGSK
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaaggaacagattatagatgcaatcaaaaaatacaatacgattattctgcacagacat
gttcggccagaccctgatgcatatggatcacaatgtggattgggagaaatcattaaatat
tcctttccagaaaaacaagtattcatggttggtcaagaagaggaatctttacattttcta
aagcgacttgatgtgattccggatgaagcatatgaaggagcattagtgattgtttgtgat
acagccaatcaggaaagggtctgtgatcaacggtatacgaggggggatcttttgattaaa
atagatcatcatccaaatgaggatccttacggagattttttgtgggttgatacatcagca
agctcttgcagtgaaatgatttatgaattatatgagtacggtaaggataaaggattacga
atgaatcaggaggcagcgcgattattatatgcaggaatcgtaggtgatacgggtagattt
ttatatccaagtactaccgataaaacatttctgtatgccggcgagcttattcagtacgga
tttaatcgcacggatatatacgatggtatgtatgatgttgatgaagcggtcgttcgtttg
aatggctatgtttttgaaaactttaaaataattgattcaggagttggggtagtcgtaatt
acgaaggaagtcatggaacgatttggtgtaaaatcctccggagcatcttcacttgtcagt
actttgggatctgtaaagggaatcaaggcatgggtatttttcattgaagaaaatgatgaa
attcgagttcgtctcagatcaaaaggccctgttattaatggtgtagctatgaaatataat
ggaggcgggcatcccttagcatctggcgcaaccatttacaattgggaggacatgaataat
gtccttgcagatctcgtacaggtttgttccaactatggatccaaataa

DBGET integrated database retrieval system