KEGG   Pradoshia sp. D12: F7984_15245
Entry
F7984_15245       CDS       T06218                                 

Definition
(GenBank) aminopeptidase P family protein
  KO
K01271  Xaa-Pro dipeptidase [EC:3.4.13.9]
Organism
prd  Pradoshia sp. D12
Brite
KEGG Orthology (KO) [BR:prd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:prd01002]
    F7984_15245
Enzymes [BR:prd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.9  Xaa-Pro dipeptidase
     F7984_15245
Peptidases and inhibitors [BR:prd01002]
 Metallo peptidases
  Family M24
   F7984_15245
SSDB
Motif
Pfam: Peptidase_M24 Creatinase_N
Other DBs
NCBI-ProteinID: QFK72505
UniProt: A0A5J6XQQ7
LinkDB
Position
3177414..3178505
AA seq 363 aa
MSNLNHLANWLTEKQADAAFITSTENVFYLSGFYSDPHERLLAVITFPTEEPILICPQME
VSDAKQAGWGYEVLGISDTQNPWEVIKETLKKRNISIQTLAVEKEHLTMERLEGLNSILN
QPTYISAEEKMRQLRMIKSPSELKIIKEACRLADYAIKIGTEEIAEGKTEMEILAALEYQ
LKREGVSEMSFATMVLTGENAASPHGVPGQTKVKKGDLVLFDLGVVVDGYCSDITRTVAF
GQINEEQREIYNTVLEAQIAAVEACRPGKTCAEIDLTARNIIRNKGYGDYFPHRLGHGLG
ISVHEYPSLTEINTLSLQEGMVFTIEPGIYVPGKAGVRIEDDLYVTENGVEILTKFPKEL
VTI
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgagtaacttaaatcacttggcaaattggcttaccgaaaaacaggctgatgctgctttt
atcacgtctacagaaaatgttttttacctaagtgggttctatagcgatcctcatgaacgc
ttattggcagtaattactttccctactgaagaacctattttaatttgcccgcaaatggag
gtttcagacgcaaaacaggctggctgggggtatgaagtgcttggcatttctgatacccaa
aatccatgggaagttattaaagaaacactgaaaaaaagaaacatttctattcaaactctg
gcagtggaaaaagaacatttaactatggaacgacttgaaggacttaattcaattttaaac
cagccgacatatatatcggcggaagaaaaaatgcgtcaactgcgtatgattaaaagtcca
tctgaattaaaaatcattaaagaagcttgccgtcttgctgactatgccataaaaatcgga
actgaagaaattgcagagggtaaaacagaaatggaaatcctggctgctttggagtatcaa
ttgaaaagagaaggcgtatccgaaatgtcctttgcaacaatggtgctaactggtgaaaac
gccgcttcccctcatggagttcctggacaaacgaaagtcaaaaaaggtgacctggttcta
ttcgacttaggtgttgtggtagatggatattgttctgatattacacgtacagttgctttc
ggacaaattaatgaagaacaaagggaaatttacaacactgttcttgaggctcaaattgct
gcagttgaagcatgccgacctggaaaaacttgtgccgaaatagatttaacagcacgtaat
attattagaaataagggatatggtgactatttccctcatcgtcttggtcatggccttgga
attagcgttcacgaatatccttccttgaccgaaatcaatacactgtctcttcaggaagga
atggtctttacgattgagccgggtatttatgttcctggcaaagccggcgttcgcatagag
gatgatctatatgtgactgaaaacggggtagaaattcttactaaattcccgaaagaacta
gtaactatttaa

DBGET integrated database retrieval system