KEGG   Pradoshia sp. D12: F7984_15275
Entry
F7984_15275       CDS       T06218                                 

Definition
(GenBank) EcsC family protein
Organism
prd  Pradoshia sp. D12
SSDB
Motif
Pfam: EcsC
Other DBs
NCBI-ProteinID: QFK72511
UniProt: A0A5J6XT91
LinkDB
Position
complement(3182727..3183560)
AA seq 277 aa
MALTKRDQEIWMEIKEWEAEMKASEPTDFETYYDRWIENMFTLLPESTQQEFFSKMDNWL
FHLHSMIHESQFQLDARNRILTNARVFDENISTLKDLKELSIDQLAYIAEQQVARHRMYS
LVQGGISAVNGGVALAADLPAQMVINLRSIQLIGISYGFEMNTPYEIMISLKVFHAGTMP
ERMQKYFWETLMEDLDHSPSYFYEGEDELSNVFWFDQPIKQMMKVMAIYFFRKKVFKGIP
ILSMAIGSGANYRLTKKVTDFADKFYKYRYLSEKENL
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcgttgacgaaacgggatcaggaaatttggatggaaataaaagagtgggaagcggag
atgaaggcaagtgagccaaccgattttgaaacatattatgatcggtggatagagaatatg
ttcacgctgttgccggagagtacacaacaggagtttttctcgaaaatggataattggtta
tttcacctgcactccatgattcatgagtctcaattccaacttgatgcaaggaatcgtata
cttacaaatgcccgcgtttttgatgaaaatatatcaacactaaaagacttaaaagagctt
tccattgatcagttggcctatatcgctgaacagcaagtggccagacatcggatgtattct
ctcgttcagggaggtatttcggctgtaaatggaggggtggctttagcagcggatttgccg
gctcaaatggtgatcaatttaaggagtattcagctgattggaatttcatatggttttgaa
atgaacaccccatatgaaattatgatttcactaaaggtattccatgctggtacaatgcca
gaacgtatgcaaaagtatttctgggagaccttaatggaggatttggatcattcaccttct
tatttctatgaaggggaagatgagttgagcaatgttttttggtttgatcagcctattaaa
caaatgatgaaggtgatggctatatatttctttaggaaaaaggtatttaagggaatacca
attctaagcatggctatcggttcaggtgctaattatcgtctaacaaaaaaagttacggat
tttgcagataaattttataaatatcgttacttaagtgaaaaagagaacctttga

DBGET integrated database retrieval system