KEGG   Pradoshia sp. D12: F7984_15295
Entry
F7984_15295       CDS       T06218                                 

Gene name
ytfJ
Definition
(GenBank) sporulation protein YtfJ
Organism
prd  Pradoshia sp. D12
SSDB
Motif
Pfam: Spore_YtfJ
Other DBs
NCBI-ProteinID: QFK72515
UniProt: A0A5J6XQR8
LinkDB
Position
complement(3186979..3187452)
AA seq 157 aa
MSNHPIEGLMNSAMENLKSMIDVNTIIGDPVETPDGSVIMTVSKVGFGYAAGGSDYQISR
GGSQGTGEEKRHPFGGGAAGGVSITPIAFLIVNAHGVKMLHLNESTHLIEKILDSAPIAM
DKVESMISKVGKNNKKNNSNSQDASDSSSNESGNSFM
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtccaatcatccaattgaaggtcttatgaattcagcaatggaaaacttaaaaagtatg
attgatgttaatacgattattggtgatcccgtagaaactcctgatggcagtgtgataatg
actgtgtcaaaggttggatttggctatgcagctggaggcagtgactatcaaattagccga
ggaggaagccagggtactggcgaggagaagcgtcatccattcggtggaggagctgcaggt
ggtgtttcaatcacaccgattgcgtttctaattgttaatgctcatggtgtaaaaatgctt
catcttaatgagagtacacatctaatcgaaaaaattcttgattcagctccgattgctatg
gataaggtagaatcaatgatttcgaaggtagggaaaaacaataaaaaaaataactctaat
tctcaggatgcttcagattcctcttccaatgaatcagggaatagctttatgtga

DBGET integrated database retrieval system