KEGG   Pradoshia sp. D12: F7984_15320
Entry
F7984_15320       CDS       T06218                                 

Definition
(GenBank) acyl--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
prd  Pradoshia sp. D12
Pathway
prd00010  Glycolysis / Gluconeogenesis
prd00620  Pyruvate metabolism
prd00630  Glyoxylate and dicarboxylate metabolism
prd00640  Propanoate metabolism
prd00680  Methane metabolism
prd01100  Metabolic pathways
prd01110  Biosynthesis of secondary metabolites
prd01120  Microbial metabolism in diverse environments
prd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F7984_15320
   00620 Pyruvate metabolism
    F7984_15320
   00630 Glyoxylate and dicarboxylate metabolism
    F7984_15320
   00640 Propanoate metabolism
    F7984_15320
  09102 Energy metabolism
   00680 Methane metabolism
    F7984_15320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:prd01004]
    F7984_15320
Enzymes [BR:prd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     F7984_15320
Lipid biosynthesis proteins [BR:prd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   F7984_15320
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: QFK72520
UniProt: A0A5J6XSA8
LinkDB
Position
complement(3190782..3192365)
AA seq 527 aa
MNQQNLIAPEQYNLVSEVENNSKNETKIALIWENEYGETQKITYGELIKRVNRVGNILLE
EGLREGDKILVMIPRFIEAYVIYLAALKIGTVVIPCSEMLREKDLVYRSKHAEAKAVIVH
KPHTSLFTEIISEDSLKSFVINGNEDGWIQLDERMKDASEELQMVKTMGDDMAFLSYTSG
TTGQPKGVVHTHSWAYAHLRTAASNWLSIGEDDVVWATAGPGWQKWIWSPFLSVLGSGAT
GFVYHGKFEAEKYLKLIDQHSITVLCCTPTEYRLMAKVDSLDQYSLGSLHSAVSAGEPLN
REVIDTFQNYFGVTVRDGYGQTENTLLVGIMKGMDVKPGSMGKPTPGNNVEIINEEGQIC
QPGEVGDIAVHIKTPALFKNYYKDPERTAMQFRGDFYITGDKAKKDEDGYFWFEGRGDDI
IISSGYTIGPFEVEDALVKHPYVKECAVVGSPDEVRGQIVKAFVVLQDSVDVNDPQLVQT
LQNHVKELTAPYKYPRKITFVEDLPKTISGKIMRVELRNKEKEVYKA
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgaatcaacagaacctgatcgcaccagaacaatataatctagtcagcgaggtagaaaat
aacagtaagaacgaaaccaaaatcgctttgatttgggaaaatgaatacggggaaacacaa
aaaattacgtatggagaattgattaaaagggtgaatagagttggcaatattttgttagag
gaagggttgagggagggggataaaattctcgtcatgattcctcgctttattgaagcgtat
gtgatttacttagctgctttaaaaataggtacagtggtcataccatgttctgaaatgctt
cgagaaaaagatcttgtttatcgaagcaagcatgcagaagcaaaagcggtaattgttcat
aagcctcatacctctttatttacagaaattatatcggaggattcactgaaatcatttgtt
ataaatggaaatgaagatgggtggattcaactggatgaacgaatgaaagacgcttcagaa
gagttacaaatggtgaaaaccatgggagatgatatggcctttttatcctatacttcaggt
acaacagggcaaccaaagggagttgtccacactcatagctgggcctatgcacatctcaga
acagctgcctcaaactggttatcaataggtgaagatgatgttgtatgggctacagccgga
cctggatggcaaaagtggatttggagtccctttttatctgttcttggatcgggagctact
gggtttgtatatcacggaaagtttgaagcagagaaatatttaaaattaattgatcagcat
tcaattactgttttatgctgtacccctacggaatatcgattgatggcgaaggtagacagc
ctcgatcaatatagcctgggaagcctacatagtgccgtttcagcaggtgagccgcttaat
agagaagtgatcgatacgtttcaaaactatttcggggtcaccgttcgtgatggatacggg
caaacagaaaatacccttctggtcggtatcatgaaggggatggatgtgaagccgggttcc
atggggaaaccaacccctggaaataacgtagaaattattaatgaggaggggcagatttgc
caacctggcgaagtaggcgatatagctgtccacattaaaactcccgcgttgtttaaaaat
tactataaggatccggaacggacagcaatgcagtttagaggcgatttttatattacagga
gataaagctaaaaaagatgaggacgggtatttttggtttgaaggacgcggtgacgatatt
attatcagttcgggttataccattgggccatttgaagtggaggatgcacttgttaaacat
ccatatgtgaaggagtgcgctgtagtagggagtccggatgaggtaagagggcaaatcgta
aaagcgttcgtagtcttacaagatagcgttgatgtcaatgatcctcaattggtgcaaacc
ttgcagaaccatgttaaagagcttacagccccatataaatatccaagaaaaattactttt
gtggaagatttgccgaaaacaatcagcggcaaaataatgcgtgtcgaattaagaaataag
gagaaagaagtatataaggcgtaa

DBGET integrated database retrieval system