KEGG   Pradoshia sp. D12: F7984_15325
Entry
F7984_15325       CDS       T06218                                 

Definition
(GenBank) alpha/beta-type small acid-soluble spore protein
  KO
K06418  small acid-soluble spore protein A (major alpha-type SASP)
Organism
prd  Pradoshia sp. D12
Brite
KEGG Orthology (KO) [BR:prd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    F7984_15325
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: QFK72521
UniProt: A0A5J6XTA6
LinkDB
Position
complement(3192534..3192734)
AA seq 66 aa
MSNNSNNLLVPGVEQALDQMKYEIASEFGVQLGAETTSRANGSVGGEITKRLVQMAEQQL
GGGFSR
NT seq 201 nt   +upstreamnt  +downstreamnt
atgtcaaataactcaaacaatcttttggtaccaggagttgaacaagctcttgaccaaatg
aaatatgaaatcgcttctgagttcggtgtacaacttggagcagaaacaacttctcgtgct
aacggttctgttggaggagagattactaagcgtcttgttcaaatggctgaacaacaattg
ggtggaggattctccagataa

DBGET integrated database retrieval system