KEGG   Pradoshia sp. D12: F7984_15350
Entry
F7984_15350       CDS       T06218                                 

Definition
(GenBank) TetR/AcrR family transcriptional regulator
Organism
prd  Pradoshia sp. D12
SSDB
Motif
Pfam: TetR_N TetR_C_9
Other DBs
NCBI-ProteinID: QFK72526
UniProt: A0A5J6XS07
LinkDB
Position
complement(3198019..3198681)
AA seq 220 aa
MLIIKGEDKFMDKLSNKKDDIFEAAVYLFYMKGYSATSIRDIAGRAGGNSANIAYHFQHK
QGLLEYCFTDFFEGYISGIENIAEQLPLIGPKECVLKYTKFCLHYYREKFLLTRLVLREI
SVDSSLNREIYTTYLSKEKFYINLFLDAGMDCGELKKINPSMFVMKLKALLNEPFIQAQY
FSEVWQLFTNELYFINKYQLEIERFLNDCLFEERVCPVPI
NT seq 663 nt   +upstreamnt  +downstreamnt
atgttaatcataaagggggaagataaatttatggataaactatcgaataaaaaagatgat
atttttgaagctgctgtctatttattctatatgaaaggttattcagcaacttcaatcaga
gatatcgctggccgtgccggaggtaattcagcaaatatagcttatcactttcagcataag
caaggtctccttgaatattgttttacagatttcttcgaaggctatataagcggtattgaa
aatatcgctgaacaactcccactcattggtccgaaagaatgtgtcttaaagtataccaaa
ttttgcttgcattattacagagaaaagttcctattaacacgtcttgtattaagagaaata
tcagtagactcaagcctgaacagagaaatctatacaacctatttatcgaaagaaaaattt
tatattaatttattccttgatgctggtatggattgcggtgaattaaaaaagattaatcca
tctatgtttgtcatgaagctaaaagcattactgaatgaaccctttattcaggcccaatac
ttcagtgaggtttggcaattatttacgaacgaattgtattttataaacaagtatcagtta
gagattgaacgatttcttaatgactgcttatttgaggagcgtgtttgccctgtccccatc
tga

DBGET integrated database retrieval system