KEGG   Pradoshia sp. D12: F7984_15420
Entry
F7984_15420       CDS       T06218                                 

Gene name
aroF
Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K13853  3-deoxy-7-phosphoheptulonate synthase / chorismate mutase [EC:2.5.1.54 5.4.99.5]
Organism
prd  Pradoshia sp. D12
Pathway
prd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
prd01100  Metabolic pathways
prd01110  Biosynthesis of secondary metabolites
prd01230  Biosynthesis of amino acids
Module
prd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F7984_15420 (aroF)
Enzymes [BR:prd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     F7984_15420 (aroF)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     F7984_15420 (aroF)
SSDB
Motif
Pfam: DAHP_synth_1 CM_2 NeuB IGPS GFO_IDH_MocA
Other DBs
NCBI-ProteinID: QFK72537
UniProt: A0A5J6XQR1
LinkDB
Position
complement(3216283..3217368)
AA seq 361 aa
MSNMELDVLREQLDNLNLQLLKLINERGKVVQQIGELKGKQSQYRFDPVREREMLNTLIQ
NNDGPFEKSTIEHIFKEIFKASLELQEDDHRKALLVSRKKHPDDTIIDLKGEKVGNGQPS
FVFGPCAVESYEQVATVAKAVKDKGYKLLRGGAYKPRTSPYDFQGLGEEGLKILKRVADE
FDLAVISEIVNPADIETAVKYIDVIQIGARNMQNFELLKAAGAVNKPVLLKRGLAATIEE
FINAAEYIMAQGNGNIILCERGIRTYEKATRNTLDISAVPILKKETHLPVMVDVTHSTGR
RDLLIPTAKAALAIGADGVMAEVHPDPAVALSDSAQQMDLNQFDTFVNEINQFTKQTGIR
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
ttgagtaatatggaactggatgtattaagagaacaactggataatttgaatttgcaatta
ttaaagcttattaacgaacgaggaaaagttgtacaacaaatcggtgaattaaaaggtaag
caaagccagtatcgttttgatcctgttagagaaagagaaatgcttaatacacttatccaa
aataatgatggtccatttgaaaaatcaaccattgaacatattttcaaggaaatatttaaa
gcaagccttgaactacaggaagatgatcatcgtaaagcattgcttgtttcccgtaaaaag
catcctgatgatactataattgatttgaagggtgagaaagtgggaaatggacaaccgtcc
tttgtgtttggcccatgtgcggtagaatcctatgaacaagtagcgactgtagcaaaagct
gttaaggataaaggatataaattacttcgaggcggagcttataaaccgagaacatcccct
tatgatttccaagggttgggtgaagaaggattaaaaatcctgaaaagggttgctgatgaa
ttcgatttggctgttataagcgaaattgtaaacccggcggatattgagactgcggttaag
tatattgatgtgatccagattggtgctcgtaatatgcagaactttgagttgttaaaagca
gcgggagcggtcaataaacccgttctgctaaaaagagggctggcagcgacaattgaagag
ttcattaacgcagctgaatatataatggcgcagggaaatggaaatatcatattatgtgaa
cgcggaattcgtacgtatgaaaaagctacacggaatacattggatatttcagctgtacct
atactgaaaaaggaaacgcatttaccggtaatggtggatgttacgcattcgactggccga
agagatctgctaattccaactgctaaagctgcattggcaatcggtgctgatggggttatg
gctgaagttcatccggatccggcagttgctctttccgattccgcacaacagatggatcta
aaccaatttgatacgtttgtaaacgagattaatcaatttaccaagcagacaggtatcaga
atttaa

DBGET integrated database retrieval system