KEGG   Pradoshia sp. D12: F7984_15440
Entry
F7984_15440       CDS       T06218                                 

Definition
(GenBank) DUF948 domain-containing protein
Organism
prd  Pradoshia sp. D12
SSDB
Motif
Pfam: DUF948 FlaC_arch Laminin_I DUF2730 Laminin_II DUF1664 Seryl_tRNA_N Focal_AT GAS DUF4446 DASH_Duo1 V-SNARE_C COG6 HrpB7 Sec34 ADIP MukF_M Spectrin DUF16
Other DBs
NCBI-ProteinID: QFK72541
UniProt: A0A5J6XTC1
LinkDB
Position
complement(3220867..3221370)
AA seq 167 aa
MEIILYLSVALIAIAFLVLVIYLSRTLKSLQTTMESVSSTLTGLETQMQGITTETTLLLH
KTNALAEDIQHKSENLNTVVDAVKGVGGSIQRVNQTIDQITNRVQLAASQNDEKITQVVQ
WGNACIELVNKWKKHKAEQSTAIYTESEAGRDVTLPSQETRYQRSQS
NT seq 504 nt   +upstreamnt  +downstreamnt
atggaaattatcttatatttaagcgtggcattgattgccatagcgttcctggttcttgtt
atttatctttcaagaacattaaaatcccttcaaacaacaatggagagtgtatctagcaca
ttaacaggcctagaaactcagatgcaaggcataacaaccgagacaacactgctgctacat
aagacgaatgctttggctgaagatattcagcataaatctgagaatctaaatacggttgtt
gatgcagttaaaggtgtgggaggatcgattcaacgtgtgaatcaaaccattgaccagatt
acaaaccgagttcaattagcagcgagtcaaaatgacgaaaaaattacccaagtagttcaa
tggggaaatgcatgcattgagcttgtgaataagtggaaaaagcataaagctgaacagagt
acagcaatctataccgaatctgaagcaggcagagatgttactttaccttcacaagaaacc
agatatcaacgttctcaatcttaa

DBGET integrated database retrieval system