KEGG   Pradoshia sp. D12: F7984_15450
Entry
F7984_15450       CDS       T06218                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
prd  Pradoshia sp. D12
Pathway
prd00471  D-Glutamine and D-glutamate metabolism
prd00550  Peptidoglycan biosynthesis
prd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    F7984_15450
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F7984_15450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prd01011]
    F7984_15450
Enzymes [BR:prd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     F7984_15450
Peptidoglycan biosynthesis and degradation proteins [BR:prd01011]
 Precursor biosynthesis
  Amino acid ligase
   F7984_15450
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C DUF5751
Other DBs
NCBI-ProteinID: QFK72543
UniProt: A0A5J6XRU8
LinkDB
Position
complement(3222707..3224008)
AA seq 433 aa
MTVYHFVGIKGSGMSALAQILNDMGYQVQGSDYEKRFFTQIALENAGIKILPFNKENIKP
GMTIIAGNAFPDSHDEIVQALELGLPVIRYPRFLGDFLKKFVSIAVTGAHGKTSTTGLMS
HVISGAEPTSFLIGDGTGKGEADSKYFVFEACEYRRHFLSYDPDYAIMTNIDFDHPDYFA
NLDDVFSAFQEMALQVNKGIIACGDDEQLQKIQAKVPVIFYGFNEENDFQAKNIVTSEAG
TTFDVHVRNNYYETFTIPMFGRHTVLNALAVIALCQYEDIDVEIIKERLMSFTGVKRRFS
EKQLDHQILIDDYAHHPTEIKATIDSARQKYPDREIVAVFQPHTFSRTQKFLDDFAESLK
EADKVYLCEIFGSARELNGKLTVKDLCNKVDGAQIIQEEDPSILKNHHNGVLLFMGAGDI
QKVQAAYESFITK
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgacagtttatcacttcgtaggtataaaaggatccgggatgagcgcgttagcccaaatc
ctaaatgatatgggatatcaggtacagggttcagattatgaaaaaagattttttacccaa
atcgcacttgaaaatgccggtataaaaatattgccatttaataaagaaaatattaaacca
ggtatgacaatcattgcaggaaatgcttttcctgatagtcatgatgagattgttcaagct
ttagaacttggtttgccagtcattcgctatccacgatttcttggagatttccttaaaaag
ttcgtgagcatagctgttacaggcgcgcatggaaaaacatcgactaccggcttaatgtct
catgtaatcagcggagctgagccaacgtcatttttaattggagatggaacgggtaaggga
gaagcagattctaaatactttgtattcgaagcttgcgaataccgaagacactttttatcc
tacgatccggattatgccattatgaccaatattgattttgaccatccggattattttgca
aatcttgatgatgtgttctctgcctttcaagagatggcactgcaagtaaataaaggaatt
attgcctgtggtgatgatgagcagctacaaaaaatccaggcgaaagtaccggtcatattt
tatgggtttaacgaagaaaatgatttccaggctaaaaatattgtcacttcagaagctgga
actacattcgatgtgcatgtaagaaataattattatgagacatttacgattccaatgttt
gggcgccatacagttttaaatgcgctagctgttattgcactttgtcaatatgaggatatt
gatgtggagatcattaaggaacgcctaatgtcatttactggcgttaagagacgtttctct
gaaaaacaacttgatcatcaaatcttaattgatgattatgcccatcatccaacagagata
aaggcaacaattgattcagctcgacaaaagtatcctgatcgggagattgtagctgtattt
cagccgcataccttctctagaactcagaagtttttggatgattttgctgaaagcttaaaa
gaagcagataaagtatacttatgtgaaattttcggatcagcaagagagttgaatgggaaa
ttaacagttaaagatctttgtaataaggtggacggtgctcaaattattcaggaggaagat
ccgtctatccttaaaaatcatcacaatggtgtattattatttatgggtgctggagatatt
caaaaagtgcaagcagcctatgagagctttataacgaaataa

DBGET integrated database retrieval system