KEGG   Pradoshia sp. D12: F7984_15455
Entry
F7984_15455       CDS       T06218                                 

Definition
(GenBank) hypothetical protein
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
prd  Pradoshia sp. D12
Brite
KEGG Orthology (KO) [BR:prd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:prd03036]
    F7984_15455
Chromosome and associated proteins [BR:prd03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    F7984_15455
SSDB
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_gamma DUF87 AAA_10 AAA_22 P-loop_TraG T2SSE DEAD pATOM36 AAA_29
Other DBs
NCBI-ProteinID: QFK72544
UniProt: A0A5J6XTM3
LinkDB
Position
complement(3224326..3227394)
AA seq 1022 aa
MSFFKKIIDWFYEDVEEEVEVEPRNSHENIQKKPKQVKRQKENQIEIEARIQYRYPKDNF
KFPLISDEELIRLKEQKKKQNELGVKKEVHVRRFEKSPAAVPKLKVSNQRIIPKPEPKQN
EVVPNKKPFRRTEIPSPIYGFQNRQAGTKNQKTVEYELPPETTLDSVLALMHGKKVNPPS
VNQEPSFEMERQNELPLNSDFKHSDEEIKEEQQKVSTNDGNRHTEDIESVIAPLLPDTVS
AEDTEVAATSEIAWNPVSENQIIEEMNEAILNADYEDEITQEEGIVEEDTLIMHSGSQME
QEEFQSIPMIHQNLDEQADDENLENNFGLQPEEPVEDYYHSPSGSEVYEDIEEADSDMEE
DQPYKRDEIQQAHDLITQTNDSVMNIEENHQVSGNDEKNIDISHNEKNGQDIILLDGTED
EFSIKDIQTNEPVSNESIASFETQSIDRTNGLEKSAQLDDTENHIDREVSLSEPNSPMEA
TVTSDAMDEEERRKIEREKRIRERRKHIPFNVLMLKNDKDHIAANRNQKTIAGKEEKPSE
QPKKKLNDSYQYPDISILKPRVDIREDADWLAEQAALLDDTLEQFNVKARVHTYSQGPSV
TRFEVQPDPGVKVSKITNLNDDLKLSLAAKDIRIEAPIPGKRMIGIEIPNINTRPVYLRE
VLEEKVFAENTSPLSVAVGLDISGNPIVTDLKKMPHGLVAGSTGSGKSVFINSVLISLLY
KSHPSDVRLLLIDPKMVELAPYNNIPHLAAPVITDVKAATAALKWAVEEMERRYELFAHS
GVRDIVRYNEKALSSGQMEHKLPYLVIVIDELADLMMMSPADVEEAICRIAQKARACGIH
LLVATQRPSVDVITGLIKANIPTRIAFSVSSQVDSRTILDQSGAEKLLGRGDMLFLENGT
SKTVRLQGTFVTDDEIEDVVKHVMAQAKPSFMFEPNELVKTSEHIEEKDELYYEVCEFAV
EMGGASISSLQRRFRIGYNRAARLIDMLEKEGILSESKGSKPRDVLISESDLEAIHESQS
PF
NT seq 3069 nt   +upstreamnt  +downstreamnt
atgagctttttcaaaaaaatcattgattggttctatgaggatgtagaagaggaagtagaa
gtagaacctcgtaatagccatgaaaacattcaaaaaaaacctaaacaagtaaaaagacaa
aaagaaaatcaaattgaaattgaagcaagaattcaatatagatacccaaaggataatttc
aaattcccattaatctcagatgaagagttaataagattaaaagaacaaaaaaagaagcaa
aatgagttgggtgtgaagaaggaagtgcacgtgaggagatttgagaaatccccggctgct
gttcctaaattgaaagtgtctaatcaaagaataatacctaagccagaaccaaaacagaac
gaagttgttccgaataaaaagccgtttagaagaacagaaataccttcgcctatttatgga
tttcaaaatcgacaggccggcactaaaaatcaaaaaacagtcgaatacgaattaccacct
gaaacgaccttagattccgttcttgctttaatgcatggaaagaaagtgaatccaccgagt
gtcaatcaagaaccatcatttgaaatggaaagacagaatgagctgccgctgaattccgat
ttcaagcattcagatgaagagataaaagaggaacagcaaaaagtctcgactaatgatgga
aatagacatacggaggatatcgagagtgtgattgctccgctattaccggatactgtttca
gcagaagatacagaggttgcagccacaagtgaaatagcatggaatccagtcagcgagaat
cagataatagaggaaatgaatgaagcaattttgaacgctgattacgaagatgaaataact
caagaagaaggaatcgtggaagaagatacgctgatcatgcactctggctcacagatggag
caggaggaatttcagtcgattccaatgattcatcagaatcttgacgaacaagctgatgat
gaaaatttggagaacaactttggattacaaccggaggaaccagttgaagattactaccat
tccccttcaggcagtgaggtatatgaggatattgaggaagctgattctgatatggaggaa
gaccaaccatacaagagagatgaaattcagcaagctcatgatttaatcacgcagaccaat
gattctgtaatgaatatagaagaaaatcatcaggtaagcggaaatgatgagaaaaatata
gacatcagtcacaatgagaaaaatgggcaggatatcattttgcttgacggaactgaggat
gagttttcaatcaaggacattcaaacgaatgagccagtttcgaatgaatctatagcttcg
ttcgaaacgcagtcaatcgatcgaactaatggtttggagaaatccgcgcaactggatgat
acggagaaccatatagatagagaagtctctttatcagagccgaacagtccaatggaagca
acagtgacaagcgatgctatggatgaagaagagagacgaaaaatagaaagagaaaagcgc
attagggagcgcagaaaacacattccttttaacgttttaatgcttaagaatgataaagat
catattgcagcaaatcgcaatcaaaaaacgattgccggcaaagaggaaaagccttcggag
caacctaaaaaaaaactgaatgattcctatcaatatccggatatttcaattttgaagcca
cgagtggacattagagaagatgctgattggcttgcagaacaagcagcattgctagatgat
acacttgaacaattcaatgttaaggctagagtacatacgtattctcaaggaccttctgta
acaagatttgaggttcagccggatcctggtgttaaggttagtaaaatcacaaatttaaat
gatgatctaaaactaagcctggctgctaaagatattcgtatagaagcaccgattcccggg
aaacgaatgattggaattgaaattcccaatataaatacacgtcctgtttatctgcgtgag
gttttggaggaaaaagtttttgctgagaatacctcaccgctttcagtggcagttgggttg
gacatttcaggaaacccgattgtaacagatttaaagaaaatgccgcatggtttggtggca
ggctctacaggttctggaaaaagtgtatttattaactctgttttaatcagtttattatat
aaatcacacccatctgatgtcagactcttattaattgatccgaaaatggttgaacttgcg
ccatataacaatattccgcatttggcagcaccggttattactgatgtaaaagctgcaaca
gctgcactgaaatgggcagtagaagagatggaacggagatatgagttgtttgcccattca
ggagtgagagatattgtcagatataatgaaaaggcactatcatccgggcaaatggagcat
aagctgccttatttagttatcgtgattgatgagctggctgatttaatgatgatgtctcct
gctgacgtagaggaagcgatctgccgtattgcgcagaaagccagagcatgcgggattcat
ttactggtggcaacacaaagaccatctgtagatgtcattaccgggttaatcaaagcaaat
attcctacaagaattgctttttccgtttcttcacaggtagattcacgtacgattttggac
caaagtggagctgaaaaattacttggacggggagatatgctgtttttggaaaatggaact
tctaaaacagttcgcctgcagggaacttttgtaactgatgatgagattgaggatgtcgta
aaacatgtaatggctcaggctaaaccgtcctttatgtttgagccaaatgaattggtaaaa
acaagtgaacatatagaagaaaaggatgaactctattacgaagtgtgtgaatttgcggtt
gagatgggaggagcatccatatccagtctgcaaaggcgctttaggattggttataacagg
gcagcgaggctgattgatatgctggagaaagaaggtattttatcagaatcaaaaggaagt
aaacctcgtgatgtgcttatatctgaatctgatttagaggctatacatgaatctcaatcc
cctttttga

DBGET integrated database retrieval system