KEGG   Pradoshia sp. D12: F7984_15540
Entry
F7984_15540       CDS       T06218                                 

Gene name
dat
Definition
(GenBank) D-amino-acid transaminase
  KO
K00824  D-alanine transaminase [EC:2.6.1.21]
Organism
prd  Pradoshia sp. D12
Pathway
prd00310  Lysine degradation
prd00330  Arginine and proline metabolism
prd00360  Phenylalanine metabolism
prd00472  D-Arginine and D-ornithine metabolism
prd00473  D-Alanine metabolism
prd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    F7984_15540 (dat)
   00330 Arginine and proline metabolism
    F7984_15540 (dat)
   00360 Phenylalanine metabolism
    F7984_15540 (dat)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    F7984_15540 (dat)
   00473 D-Alanine metabolism
    F7984_15540 (dat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:prd01007]
    F7984_15540 (dat)
Enzymes [BR:prd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.21  D-amino-acid transaminase
     F7984_15540 (dat)
Amino acid related enzymes [BR:prd01007]
 Aminotransferase (transaminase)
  Class IV
   F7984_15540 (dat)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-ProteinID: QFK72559
UniProt: A0A5J6XTU8
LinkDB
Position
complement(3243934..3244788)
AA seq 284 aa
MDYIVHNGVLSKRETIAIDIEDRGYQFGDGIYEVIRIYNGKLFAWEGHSRRLFASAQKIG
IEIPYSPKRLKEIIEELVLKNELTTGTVYLQFTRGVSPRNHAFPGKEVVPTFIAYTRESE
RPVVLMESGAEVCIIEDKRWLNCDIKSLNLLGNILAFEEAVKQGCKEAILNRDGMITEGS
HTNVSIIKDGILITHPANNLILNGITRQLVLMLCEELSIPYEERPFTPGELMSADEVFLS
GTTLEIIPVVKTNGQAVGKAPYTTTRKLQKAFLAKIENECGRLK
NT seq 855 nt   +upstreamnt  +downstreamnt
atggattatattgttcacaatggcgtcctttcgaaaagagaaacaattgccatcgatata
gaagatcgtgggtatcaatttggggatggtatctacgaggttatacggatttataatgga
aagctatttgcgtgggaagggcatagcaggcgtctgtttgcaagcgcacaaaagatcggc
atagagataccctacagtccgaaacgccttaaggagattattgaggaattggttcttaaa
aatgagctgactaccggtactgtttatctgcaatttacacggggggtttcaccgcggaat
catgcttttccaggtaaagaggtggtaccgacctttatcgcttatacaagagaatctgaa
cgtcctgttgtactgatggagtcaggtgctgaagtctgtattattgaagataaacggtgg
cttaattgcgatattaaaagcttgaaccttctcggtaatatcctagcctttgaagaggcg
gttaaacagggatgtaaggaagcgattttaaacagagatggcatgataacagaaggcagt
catacgaatgtatcgattataaaggatggtattctgattactcatcctgcaaacaatcta
attttaaatgggattaccaggcagttggttttaatgctttgtgaggagctttcaattcct
tacgaagaaagaccatttacacctggggaattaatgtcggctgatgaggtatttctgtct
ggtaccacattagaaattatacccgttgtaaaaaccaacggacaagcggttggaaaagcc
ccatatactacaacaagaaagcttcagaaagccttccttgctaaaattgaaaatgaatgc
ggaagattaaagtaa

DBGET integrated database retrieval system