KEGG   Pradoshia sp. D12: F7984_15610
Entry
F7984_15610       CDS       T06218                                 

Definition
(GenBank) methyltransferase domain-containing protein
Organism
prd  Pradoshia sp. D12
SSDB
Motif
Pfam: rRNA_methylase Methyltransf_31 Methyltransf_5 Methyltransf_25 Ubie_methyltran GCD14 PCMT Methyltransf_24 MTS PrmA Methyltransf_12 Methyltr_RsmB-F
Other DBs
NCBI-ProteinID: QFK72572
UniProt: A0A5J6XQF1
LinkDB
Position
3257055..3257621
AA seq 188 aa
MKLDRILPFARLLLEKAVKPGDIAIDCTMGNGHDTVFLANLTGPDGHVYSFDIQESALQK
TEERLMTNELQERVTLIHAGHERLQEFIPTGKSVTGAIFNLGYLPGGDKEIITTAPTTIQ
AVTSLLKIMEPEGIIVLVIYHGHPGGDIERDELIKFVTELPQDTAHVLEYRFMNQKNNPP
FIIAIEKR
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaagcttgatcgtatccttcccttcgcaagactattgcttgaaaaagcagttaaacct
ggtgatatagccattgattgtacgatgggcaatgggcatgacaccgtatttttagcaaat
ttaactggtccggatggacatgtatacagcttcgacattcaggaatctgccttgcaaaaa
acggaagagagactgatgacaaatgagcttcaggagcgggtaacactaattcatgcaggt
catgagcgtttacaggaatttatcccaactggcaaatctgttacaggcgcaatctttaat
ttaggctatttgcctggcggcgataaagaaattattacaaccgctcctactacgattcag
gctgtaacgtcattactcaaaattatggagcctgaaggcatcatagttcttgtcatctat
cacggtcatcccggcggagacattgaacgtgacgaattaatcaaattcgttacagagctt
ccacaggatacggcccatgtgctggaataccgatttatgaatcaaaaaaacaatccgcca
tttattatcgctatcgaaaaacgttaa

DBGET integrated database retrieval system