KEGG   Pradoshia sp. D12: F7984_18310
Entry
F7984_18310       CDS       T06218                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
prd  Pradoshia sp. D12
Pathway
prd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:prd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    F7984_18310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prd03400]
    F7984_18310
Enzymes [BR:prd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     F7984_18310
DNA repair and recombination proteins [BR:prd03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     F7984_18310
 Prokaryotic type
     F7984_18310
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: QFK73041
UniProt: A0A5J6XUE0
LinkDB
Position
complement(3813603..3814283)
AA seq 226 aa
MSHQILQNDWLEYLVDEFKQPYYAALCNFIKKEYENEIVYPKAEDIYNALNYTDFKSVKV
VLLGQDPYHGPNQAHGLSFSVQPEVALPPSLRNIFKELNDDLGIPVPNNGYLKSWADQGV
LLLNTVLTVRQGEAHSHKGRGWERLTDKIIETLNEKSEPIVFLLWGKPAQSKIHLIDQKK
HHIITSVHPSPLSARRGFFGSKPFSKTNELLRQNGLKEIDWAIPDL
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagtcaccaaattttacagaatgactggctggagtatttagtggatgaatttaaacaa
ccatattatgcagccctgtgtaattttataaaaaaggagtatgaaaacgagattgtctat
ccaaaggctgaagatatctacaacgctttgaactatactgattttaaatccgtaaaagtg
gtattgctcgggcaggatccctaccatggccccaatcaggctcatggattaagtttctct
gtacagcctgaagttgctctcccgccctcgctacggaatattttcaaggaactaaatgat
gacttaggaattccagtccctaacaatggatacttgaaaagttgggcggatcagggggta
cttttgttaaataccgttttgactgtcagacagggagaagcccattcacataaggggaga
ggatgggagcgattaacagataaaataatagagacattgaatgaaaaatcagaaccgatt
gttttcctattatggggaaaaccagcacaatccaaaattcacttaattgatcagaagaag
catcacatcattacctcggttcacccgagcccgctatctgctcggcgaggtttctttgga
agtaagccattttctaaaacgaatgaacttctccgacaaaatgggctgaaggaaatcgat
tgggccattcctgatttgtga

DBGET integrated database retrieval system