KEGG   Pseudomonas resinovorans: PCA10_10800Help
Entry
PCA10_10800       CDS       T02708                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00473  D-Alanine metabolism
pre00550  Peptidoglycan biosynthesis
pre01100  Metabolic pathways
pre01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PCA10_10800 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PCA10_10800 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PCA10_10800 (ddlB)
Enzymes [BR:pre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PCA10_10800 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pre01011]
 Precursor biosynthesis
  Amino acid ligase
   PCA10_10800 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATP-grasp_3 RimK ATPgrasp_YheCD GARS_A ATP-grasp_5 TTL
Motif
Other DBs
NCBI-ProteinID: BAN46812
UniProt: S6ACY2
LinkDB All DBs
Position
1153457..1154404
Genome map
AA seq 315 aa AA seqDB search
MSAQRQPNLEPAAFGRVAVLYGGKSAEREVSLKSGAMVLQSLQAAGVDAFGIDVGDDLLQ
RLQAEKIDRAFIILHGRGGEDGSMQGLLECLDIPYTGSGILASALAMDKLRTKQLWISLG
LPTPRHAVLASEQDCRQAAAELGFPLIVKPAHEGSSIGMAKVEGVEALIQAWQGAAVYDS
QVLVEQWIQGPEFTVAWLRGEVLPPIRLGTPHTFYDYDAKYLASDTRYQIPCGLDADKEE
ELKQLTARACETLGIQGWARADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAGLDFQ
QLVLAILTDSVQARG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcaacgccaacccaacctcgagccggccgccttcggtcgcgtcgccgtgctc
tacggcggcaagagcgccgagcgcgaggtctccctcaagtccggcgccatggtgctgcag
tccctgcaggccgcaggcgtggacgccttcggcatcgacgtgggcgacgacctgctgcaa
cgcctgcaggccgagaagatcgaccgcgccttcatcatcctccacggccgtggcggcgaa
gacggcagcatgcagggcctgctggagtgcctggacattccctacaccggcagcggaatc
ctcgcgtcggccctggccatggacaagctgcgcaccaagcagctgtggataagtctgggc
ctgccgaccccgcgtcacgccgtgctggccagcgaacaggactgccgccaggccgccgcc
gagctgggcttcccgctgatcgtcaagccggcccacgaaggctccagcatcggcatggcc
aaggtggagggcgtcgaagccctgatccaggcctggcagggcgccgccgtgtacgactcg
caggtgctggtggaacagtggatccagggtcccgaattcaccgtggcctggttgcgcggc
gaagtgctgccgcccatccgcctcggcaccccgcacaccttctacgactacgacgccaag
tacctggccagtgacacccgctaccagatcccctgcggtctggacgcggacaaggaggaa
gagctgaagcagctcaccgcgcgcgcctgcgaaaccctcggcatccagggctgggcccgt
gccgatgtgatgcaggacgccgaagggcgcttctggctcctcgaagtcaacaccgcacca
ggcatgaccgatcacagcctggtgcccatggccgcacgcgctgcgggcctggatttccag
caactggtgctggcgatcctgaccgacagcgtccaggcaaggggctga

DBGET integrated database retrieval system