KEGG   Pseudomonas resinovorans: PCA10_12700Help
Entry
PCA10_12700       CDS       T02708                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pre  Pseudomonas resinovorans
Brite
KEGG Orthology (KO) [BR:pre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PCA10_12700 (ahpF)
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PCA10_12700 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_7 Thi4 K_oxygenase FMO-like Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAN47002
UniProt: S6AD67
LinkDB All DBs
Position
1362340..1363896
Genome map
AA seq 518 aa AA seqDB search
MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVGLTDKITLKTDGSDAR
RPSFSLNRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKLDQDVIEQVKAIEGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVDARQIMSVPSLYLNGELF
SQGRMGVEEILAKIDTGAAARDADKLNAKAAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERLGGQVLDTMAIENFISVQETEGPKLARALEEHIKQYDVDIMNLQRASALIPAKAEGE
LHEVRFESGAALKAKTLILSTGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDDKLRADAVLQKKLASLPNVNVIKSALTTEVKGDG
QKVNGLVYKDRTTDQLQTLELEGIFVQIGLLPNSEWLKGVVELSPRGEIIVDAKGQTNIP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTT
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctcaaaacccagttgaaagcctacctggaaaaggtctcccagccg
ttcgagatcgtcgcgtccctcgatgacagcgacaaatcccgcgaactgctcgggctgctg
caagacatcgtcggcctgaccgacaagatcaccctgaagaccgatggcagcgacgcccgt
cgcccgtcgttctccctgaaccgtcccggcgcggatatttccctgcgcttcgccggcatc
cccatgggccacgagttcacctccctggtgctggccctgctgcaagtcggcggccacccg
tccaagctcgaccaggacgtgatcgagcaggtcaaggcgatcgagggcgagttcaacttc
gaaacctacttctcgctgtcctgccagaactgccccgacgtggtgcaggcactgaacctg
atggccgtgctcaacccgaacatccgtcacgtcgccatcgatggcgcgctgttccaggac
gaggtcgatgcgcgccagatcatgtcggtgcccagcctctacctcaacggcgagctgttc
agccagggccgcatgggcgtggaggaaatcctcgccaagatcgacaccggcgccgccgct
cgcgatgccgacaagctcaatgccaaggcagccttcgatgtgctggtgatcggtggtggt
cccgctggcgccgccgcggccatctatgccgcccgcaagggcatccgcaccggtgtggcg
gccgagcgcctgggtggccaggtgctggacaccatggccatcgagaacttcatctccgtc
caggagaccgaaggcccgaaactggcccgcgccctggaagagcacatcaagcagtacgac
gtcgacatcatgaacctgcaacgtgccagcgcactgatcccggccaaggccgagggtgag
ctgcacgaggtgcgattcgagagcggcgcggccctcaaggccaagaccctgatcctctcc
accggtgcccgctggcgcgaaatgaacgtccccggcgagcaggaataccgtggtcgtggc
gtggcctactgcccccactgcgacggcccgctgttcaagggcaagcgtgtggcggtgatc
ggcggcggcaactccggcgtggaagcggccatcgacctggccggcatcgtcgcccatgtc
accctgatcgagttcgacgacaagctgcgtgccgacgccgtgctgcagaagaagctggcc
agcctgcccaacgtcaacgtgatcaagagcgcgctgactacggaagtgaagggcgacggc
cagaaggtcaacggcctggtctacaaggaccgcaccaccgaccagctgcagaccctggag
ctggaaggcatcttcgtgcagatcggtctgctgcccaacagcgagtggctcaagggtgtg
gtggagctgtccccgcgcggcgagatcatcgtcgacgccaagggccagaccaacattccg
ggcgtgttcgccgccggcgacgtgactaccgttccgtacaagcagatcgtgatcgccgtg
ggcgagggcgccaaggcttccctgagtgccttcgatcatctgatccgtacgacctga

DBGET integrated database retrieval system