KEGG   Pseudomonas resinovorans: PCA10_21660Help
Entry
PCA10_21660       CDS       T02708                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00020  Citrate cycle (TCA cycle)
pre00190  Oxidative phosphorylation
pre00650  Butanoate metabolism
pre01100  Metabolic pathways
pre01110  Biosynthesis of secondary metabolites
pre01120  Microbial metabolism in diverse environments
pre01130  Biosynthesis of antibiotics
pre01200  Carbon metabolism
Module
pre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pre_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCA10_21660 (sdhA)
   00650 Butanoate metabolism
    PCA10_21660 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PCA10_21660 (sdhA)
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PCA10_21660 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PCA10_21660 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA FAD_binding_3 HI0933_like Thi4 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: BAN47898
UniProt: S6AQ71
LinkDB All DBs
Position
2361263..2363035
Genome map
AA seq 590 aa AA seqDB search
MASIRTLSFDAIIVGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
SDPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEQGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQANLKSGTSFLNEWYAVDLVKNQDGAV
VGIIAICIETGETVYIRSKAVVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEV
IAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPIPVIPTCHYMMG
GVATNIHGQAITQDANGNDTIVEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKEGIETRGASETDLELSLKRLSGVNERTSGEEVAPLKRELQQCMQNYFGVFRTGE
YMQKGIAQLAELRERIATVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEVRKESRG
AHAREDFEDRDDENWLCHTLYFPGDKRVTKRAVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattcgtactctttctttcgacgccatcatcgtaggtggtggcggtgccggt
atgcgcgctgcgctgcaactggctcagggcggtcacaagactgccgtggtgaccaaggtc
ttcccgacccgttcccacaccgtttccgcccagggcggcatcacctgcgccatcgcttcg
tccgacccgaacgacgattggcgctggcacatgtacgacaccgtcaagggctccgactac
atcggtgaccaggacgcgatcgaatacatgtgctccgtcggccccgaagccgtgttcgag
ctggaacacatgggcctgccgttctcccgtaccgagcagggccgcatctaccagcgtccg
ttcggtggccagtccaaggacttcggcaagggtggccaggccgcccgtacctgcgccgcg
gccgaccgtaccggtcacgccctgctgcacaccctgtaccaggccaacctgaagagcggc
acctcgttcctcaacgagtggtacgccgttgacctggtgaagaaccaggacggcgccgtg
gtcggcatcatcgccatctgcatcgagaccggtgaaaccgtctacatccgttccaaggcc
gtggttctggccactggcggtgctggccgtatctacgcctccaccaccaacgccctgatc
aacaccggcgacggcgtgggcatggccctgcgcgctggcgtgccggttcaggacatcgag
atgtggcagttccacccgaccggcatcgccggcgccggtgtactggttaccgaaggctgc
cgtggtgagggtggttacctgatcaacgcccatggcgagcgcttcatggagcgttacgct
ccgaacgccaaggacctggccggccgcgacgtggtcgcccgttcgatggtcaaggaagtg
atcgccggcaacggcgtgggcccgaacaaggaccacgtactgctgaagctcgaccacctc
ggcgaggaagtcctgcacagccgcctgcccggcatctgcgaactgtccaagaccttcgcg
cacgtcgacccggtcgtcgcgccgatcccggttatcccgacctgccactacatgatgggc
ggcgttgccaccaacattcatggccaggccatcacccaggacgccaacggcaacgacacc
atcgtcgaaggcctgttcgccgtgggcgaagtggcttgcgtgtcggtacacggcgccaac
cgcctgggcggcaactcgctgctcgacctggttgtattcggccgtgcagctggcctgcac
ctggaaaaagcgctcaaggaaggcatcgagactcgcggtgccagcgagaccgacctggag
ctgtcgctcaagcgtctgtccggcgtcaacgagcgcaccagcggcgaagaagtcgctccg
ctgaagcgcgagctgcagcagtgcatgcagaactacttcggtgtgttccgtaccggcgaa
tacatgcagaagggcatcgcccagctggccgagctgcgtgagcgcatcgcgaccgtcaag
atcaacgacaagtcccaggccttcaacaccgcgcgtatcgaagcgctggagctgcagaac
ctgctggaagtcgccgaagccaccgcgatcgctgcggaagttcgcaaggaatcccgtggc
gcccacgcccgtgaagacttcgaagatcgcgacgacgagaactggctgtgccacaccctg
tacttcccgggtgataagcgcgttaccaagcgcgccgtcaacttcgcgccgaagaccgtt
ccggcgttcgaacccaaagtacgtacttattaa

DBGET integrated database retrieval system