KEGG   Pseudomonas resinovorans: PCA10_33390Help
Entry
PCA10_33390       CDS       T02708                                 

Gene name
alaA
Definition
(GenBank) alanine aminotransferase AlaA
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00220  Arginine biosynthesis
pre00250  Alanine, aspartate and glutamate metabolism
pre00290  Valine, leucine and isoleucine biosynthesis
pre01100  Metabolic pathways
pre01110  Biosynthesis of secondary metabolites
pre01130  Biosynthesis of antibiotics
pre01210  2-Oxocarboxylic acid metabolism
pre01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PCA10_33390 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    PCA10_33390 (alaA)
   00220 Arginine biosynthesis
    PCA10_33390 (alaA)
Enzymes [BR:pre01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PCA10_33390 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     PCA10_33390 (alaA)
Amino acid related enzymes [BR:pre01007]
 Aminotransferase (transaminase)
  Class I
   PCA10_33390 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAN49071
UniProt: S6AWW5
LinkDB All DBs
Position
3685305..3686516
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGIGIEDIYLGNGVSELIVMCLQALLNNGDE
VLIPAPDYPLWTASVSLAGGKPVHYLCDEQANWWPDLDDIKAKITPNTKAMVIINPNNPT
GAVYSKEVLEGMVELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKQKAQSYIEGIDILANMRLCANVPSQHAIQTALGGYQSINDLVL
PNGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGGFLKSYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaatgtctgctacgacattcgtggaccggtg
ctcaagcacgccaaacgcctggaagaggaaggccatcgcatcctcaagctgaacatcggc
aacccggcgccgttcggtttcgaagccccggaggaaatcctccaggacgtgatccgcaac
ctccccaccgcccagggctacagcgactccaagggcctgttcagcgcgcgcaaggcggtg
atgcagtactaccagcagaagcaggtggaaggcatcggcatcgaggacatctacctcggc
aacggcgtgtccgagctgatcgtgatgtgcctgcaggcgctgctcaacaacggtgacgaa
gtgctgatcccggcgccggactatccgctctggaccgcctcggtgagcctggccggcggc
aagccggtgcactacctgtgcgacgaacaggccaactggtggccggacctggacgacatc
aaggccaagatcaccccgaacaccaaggccatggtgatcatcaacccgaacaaccccacc
ggcgccgtgtactccaaggaagtcctggaaggcatggtggaactggcgcgccagcataac
ctggtggtcttctccgacgagatctacgacaagatcctctacgacgaagccgtgcacatc
tccaccgcctccctggcgccggacgtgctctgcctgaccttcaacggcctgtccaagtcc
taccgcgtggccggcttccgttccggctgggtggccatttccggccccaagcagaaggcc
cagagctacatcgaaggcatcgacatcctggccaacatgcgcctgtgcgccaacgtacca
agccagcacgccatccagaccgccctcggcggctaccagagcatcaatgacctggtgctg
cccaacggtcgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacatcccc
ggcgtcagctgcgtcaagcccatgggcgcgctctatgcgttccccaggatcgaccccaag
gtctgcccgatccacaacgacgagaagttcgtcctcgacctgctgctgtcagaaaagctg
ctgatcgtccagggcaccgccttcaactggccgtggccggaccacttccgcgtcgtcacc
ctgccccgcgtggacgacctggagcaggccatcggacgcatcggcggtttcctcaagtcg
tatcgccagtaa

DBGET integrated database retrieval system