KEGG   Pseudomonas resinovorans: PCA10_33500Help
Entry
PCA10_33500       CDS       T02708                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
pre  Pseudomonas resinovorans
Brite
KEGG Orthology (KO) [BR:pre00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PCA10_33500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: BAN49082
UniProt: S6AG17
LinkDB All DBs
Position
3697023..3697745
Genome map
AA seq 240 aa AA seqDB search
MEVTWLALGGFILLAYTLEAITGFGSTVVALSLGALLLPIHDLLPVLVPLNILMSGFLAW
RHRRLVQWRLLLVTVLPGMLVGTLFGYGLRPWLEEGAMKLGFGVLILGFALRELLRGKPR
GHTPAWMTRLQTGAAGISHGLFASGGPLLVHALAGTALDKARLRATLLCVWFGLNSLLTL
AFLLDGSLAPALPRIAVYAPLLALGVVVGEYLHRRLAEAHFRTAIHLLLALCGMLLCYRA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcacctggctggccctcggcgggttcatcctgctggcctacaccctggaagcc
atcaccggcttcggcagcaccgtcgtcgccttgtccctgggcgccctgctgctgccgatc
cacgatctgctgccggtcctggtgccgctgaacattctcatgagcggcttcctcgcctgg
cgccaccggcggctggtgcaatggcgcctactgctggtcaccgtcctgcccggcatgctg
gtgggcaccttgttcggctacggcctgcggccctggctggaagaaggcgcgatgaaactg
ggcttcggcgtgctgatcctcggtttcgccttgcgcgagctgttgcgcggcaagccccgg
ggccacacgccagcctggatgactcgcctgcagaccggcgccgccggcatcagccacggc
ctgttcgcctcaggcggcccgctgctggtgcatgccctggccggcaccgcgctggacaag
gcgcgcctgcgcgccaccctgctgtgcgtctggttcggcctgaacagcctgctgaccctg
gccttcctgctcgatggcagcctggcgccggcgctgccccgcatcgccgtctatgcgccg
ctgctcgccctgggcgtggtggtgggcgaatacctgcaccggcgcctggccgaggcgcat
ttccgcaccgccatccacctgctgctcgcgctctgcggcatgctgctctgctaccgcgcc
tag

DBGET integrated database retrieval system