KEGG   Pseudomonas resinovorans: PCA10_37440Help
Entry
PCA10_37440       CDS       T02708                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PCA10_37440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pre02000]
    PCA10_37440
Enzymes [BR:pre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PCA10_37440
Transporters [BR:pre02000]
 Other Transporters
  Pores ion channels [TC:1]
   PCA10_37440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 GST_C_6 NigD_N Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: BAN49476
UniProt: S6AXT2
LinkDB All DBs
Position
complement(4113846..4114448)
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYKSGNCYKVKLILNLLGVPYQWVPVDILKGETESAEFLEKNPNGKIPVLELDD
GTTLWESNAILNFLAEGSDLLPAEPRLRTQVLQWQFFEQYSHEPYVAVARFIQLYQGMPE
DRLEEYKVCQVRGLKALKVMEKQLQRTPYLVGDRYSIADIALYAYTHVAHEGGFDLSGFP
AILAWLERVASHPRHVGMFD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtttacggcgattacaagtccggcaactgctacaaggtcaagctgatcctc
aatctgctcggcgtgccctatcagtgggtgccggtggatatcctcaagggcgagaccgag
agcgccgagttcctcgagaagaaccccaatggcaagattccggtgctggaactggacgat
ggcacgaccctctgggagtccaacgccatcctcaacttcctcgccgagggcagcgacctg
ctgcccgccgagccgcgcctgcgcacccaggtgctgcagtggcagttcttcgagcaatac
agccatgagccctatgtggcggtggcgcgcttcatccagctctaccagggcatgccggaa
gaccgcctggaagagtacaaggtctgccaggtgcgcggactgaaggccctcaaagtgatg
gagaagcagctgcagcgcacgccgtacctggtgggtgaccgctattccatcgccgatatc
gccctctacgcctacacccatgtggcccatgaaggtggtttcgacctctccggcttcccg
gcgattcttgcctggctggagcgcgtggccagccatccgcgtcatgtgggcatgtttgac
tga

DBGET integrated database retrieval system