KEGG   Pseudomonas resinovorans: PCA10_45720Help
Entry
PCA10_45720       CDS       T02708                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00620  Pyruvate metabolism
pre00680  Methane metabolism
pre01100  Metabolic pathways
pre01120  Microbial metabolism in diverse environments
pre01200  Carbon metabolism
Module
pre_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCA10_45720 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    PCA10_45720 (ppc)
Enzymes [BR:pre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCA10_45720 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HAMP
Motif
Other DBs
NCBI-ProteinID: BAN50304
UniProt: S6BM25
LinkDB All DBs
Position
complement(5046540..5049176)
Genome map
AA seq 878 aa AA seqDB search
MAEIDARLREDVHLLGELLGDTIRAQLGEAFLDKIERIRKGAKAARQGSAQGERQLNETL
DGLSDDELLPVARAFNQFLNLANIAEQYHRIRRRGPDEPQPFEDRVLDNLLQRLLAAGHG
PEQLARQLGRLEIELVLTAHPTEVARRTLIQKYDAMAAQLAAQDHADLSAAERDAVRLRL
LRLIAEAWHTEEIRRIRPTPLDEAKWGFAVIEHSLWQALPNVLRHVDQALHAATGLRLPL
TAAPLRFASWMGGDRDGNPNVTAAISRQVLLLARWMAADLYLRDVDHLAAELSMQQASDE
LRVRVGVHPEPYRALLKQLRDRLRATRTWAESALDADVPPCAEVLHDNTQLLEPLELCYH
SLHACGMGVIADGALLDCLRRAATFGLFLVRLDIRQDSARHAAALDEITDYLGLGNYAQW
SEEQRLTFLQRELDNRRPLLPPHYRPSADTAEVLATCKVVANAPAASLGSYVISMAGAPS
DVLAVQLLLKEAGLQRPIHVVPLFETLADLDNAAPAIDRLLGLPGYRARLHGPQEVMIGY
SDSAKDAGTVAAAWAQYRAQEQLVEVCRAHQVELLLFHGRGGTVGRGGGPAHAAILSQPP
GSVAGRFRTTEQGEMIRFKFGLPGIAEQNLNTYLAAVLEATLMPPPEPEPAWRAAMDRLA
ADGVAAYRAVVREHPQFVDYFRQATPEQELGRLPLGSRPAKRRAGGVESLRAIPWIFAWT
QTRLMLPAWLGWEAALANATQRGETRLLARMREHWPFFATRIDMLEMVLAKADANIAALY
DERLVPEELEPLGVQLRDLLSQACASVLALTGQSELLAASPETREAISVRNTYLDPLHLL
QTELLARSRRSEQHVEGPLEQALLVSVAGIAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatagatgcgcgtctgcgcgaggacgtccacctgctcggcgagttgctcggc
gacaccatccgcgcccagctgggcgaggccttcctggacaagatcgaacgcatccgcaag
ggcgccaaggccgcccgccagggctccgcgcagggcgaacgccagctcaacgagaccctc
gacgggctcagcgacgacgagctgctgccggtggcccgcgccttcaaccagttcctcaac
ctggccaacatcgccgagcagtaccaccgcatccgccgccgcggcccggatgagccgcag
cccttcgaggaccgcgtgctggataacctgctgcaacgcctgctggccgccggccatggc
ccggaacagctggcccgccagctcgggcggctggaaatcgagctggtactgaccgcccac
cccaccgaagtcgcccgtcggaccctgatccagaagtacgacgccatggccgcccaactg
gccgcccaggatcacgccgacctcagcgcggccgagcgtgacgcggtgcgcctgcgcctc
ctgcggctgatcgccgaggcctggcacaccgaggagatccgccgtattcggccgaccccg
ctggacgaggcgaagtggggcttcgcggtgatcgagcattccctctggcaggcgctgccc
aacgtgttgcggcatgtcgaccaggccttgcacgcggccaccggcctgcgcttgccgctg
accgccgcgcccttgcgcttcgcctcctggatgggcggcgaccgtgacggcaaccccaat
gtcaccgccgccatcagccgccaggtgctgttgctggcgcgctggatggccgccgacctc
tacctgcgcgatgtcgaccacctggccgccgagctgtccatgcagcaggccagcgacgag
ctgcgggtgcgcgtgggcgttcacccggagccctaccgggcgctgctcaagcagctgcgg
gaccgcctgcgggccactcgcacctgggccgaatctgcgttggacgccgatgtcccgccc
tgcgccgaggtgctccacgacaacacccagctgctggaacccctggagctctgctaccac
tcgctgcacgcctgcggcatgggcgtgatcgccgacggcgcgctgctcgattgcctgcgc
cgcgccgccaccttcgggctgttcctggtgcgcctggacatccgccaggactccgcgcgc
catgccgccgccctggacgagatcaccgactacctgggcctgggcaactacgcccagtgg
agcgaggagcagcgcctgaccttcctccagcgcgaactggacaatcgccggcccttgctg
ccgccgcactaccggccctcggccgacaccgccgaagtgctagcgacctgcaaggtggtg
gccaacgcgccggccgcttccctcggctcctatgtgatttccatggccggtgcgccctcg
gacgtgctggcggtgcaactgctgctcaaggaagccgggttgcaacgcccgatccatgtg
gtgccactctttgaaaccctggccgacctggacaacgccgcccccgccatcgaccgcctg
ctcggcctgccgggctaccgcgcgcggttgcacggcccgcaggaagtgatgatcggctac
tccgactcggccaaggacgcaggcaccgtggccgccgcctgggcccagtaccgcgcccag
gaacagctggtggaggtgtgccgcgcgcaccaggtggaactgctgctgttccatggtcgc
ggcggcaccgtggggcgcggcggcggcccggcccacgcggccatcctgtcgcaaccgccg
gggtcggtggcgggacgtttccgcaccaccgagcagggcgagatgatccgcttcaagttc
ggcctgccgggcatcgccgagcagaacctcaacacctacctggcggccgtgctggaagcc
accctgatgccgcctccggagcccgagccggcctggcgcgcggccatggaccgcctcgcc
gccgacggcgtggccgcctatcgcgccgtggtgcgcgagcacccgcagttcgtcgactac
ttccgccaggccacccccgagcaggagctcggccggctgccgctcggcagtcgaccggcc
aagcgccgtgccggtggcgtggagagcctgcgggcgatcccctggatcttcgcctggacc
cagacccgcctgatgctgccggcctggctgggctgggaggcggcactggccaatgccacc
cagcgcggtgaaacccgcctgctggcgcggatgcgcgaacactggccgttcttcgccacg
cgcatcgacatgctggaaatggtcctggccaaggccgacgccaatatcgccgcgctctat
gacgaacggctggtgcccgaagagctggagccactgggtgtgcaattgcgcgacctattg
tcgcaggcgtgcgcctcggtactggctctgaccggccagtccgaactgctggcggcgagt
ccggagacccgcgaggccatcagcgtgcgcaatacctacctggacccgctgcacctgctc
cagaccgagctcctggcccgttccaggcgcagtgagcagcatgtcgaaggccctctggaa
caggccctgctggtgagcgtggcgggcatcgcggcgggtctccggaacaccggatga

DBGET integrated database retrieval system