KEGG   Pseudomonas resinovorans: PCA10_46810Help
Entry
PCA10_46810       CDS       T02708                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pre  Pseudomonas resinovorans
Brite
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PCA10_46810 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAN50413
UniProt: S6AVV5
LinkDB All DBs
Position
5168049..5168630
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHLSAETLEFHHGKHHNAYVVNLNNLVPGTEFEGKSLEDIIKTS
SGGIFNNAAQIWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFSKTSIGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWDFVAKNYAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgagaagaacgccctcgaaccgcacctgtcc
gccgagaccctggagttccaccacggcaagcaccacaacgcctacgtggtaaacctgaac
aacctggttccgggcaccgagttcgaaggcaagagcctggaagacatcatcaagacctct
tccggcggcatcttcaacaacgcggcccagatctggaaccacaccttctactggaactgc
ctgagcccgaacggcggtggccagcccaccggcgccctggctgacgccatcaacgccgcc
ttcggttccttcgacaagttcaaggaagagttcagcaagacctccatcggcaccttcggc
tccggctggggctggctggtgaagaaggctgacggctccctggccctggccagcaccatt
ggtgccggttgcccgctgaccagcggcgacaccccgctgctgacctgcgacgtctgggaa
cacgcctactacatcgactaccgcaacctgcgtccgaagtacgtagaggccttctggaac
ctggtcaactgggacttcgtagccaagaactacgcagcctga

DBGET integrated database retrieval system