KEGG   Pseudomonas resinovorans: PCA10_p0340
Entry
PCA10_p0340       CDS       T02708                                 

Gene name
carAd
Definition
(GenBank) carbazole 1,9a-dioxygenase ferredoxin reductase subunit
  KO
K15753  carbazole 1,9a-dioxygenase ferredoxin reductase component
Organism
pre  Pseudomonas resinovorans
Pathway
pre00621  Dioxin degradation
pre01100  Metabolic pathways
pre01120  Microbial metabolism in diverse environments
pre01220  Degradation of aromatic compounds
Module
pre_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PCA10_p0340 (carAd)
SSDB
Motif
Pfam: Fer2 FAD_binding_6 NAD_binding_1
Other DBs
NCBI-ProteinID: BAN51418
UniProt: S6AY23
LinkDB
Position
pCAR1.3:32367..33356
AA seq 329 aa
MYQLKIEGQAPGTCGSGKSLLVSALANGIGFPYECASGGCGVCKFELLEGNVQSMWPDAP
GLSSRDREKGNRHLACQCVALSDLRIKVAVQDKYVPTIPISRMEAEVVEVRALTHDLLSV
RLRTDGPANFLPGQFCLVEAEQLPGVVRAYSMANLKNPEGIWEFYIKRVPTGRFSPWLFE
NRKEGARLFLTGPMGTSFFRPGTGRKSLCIGGGAGLSYAAAIARASMRETDKPVKLFYGS
RTPRDAVRWIDIDIDEDKLEVVQAVTEDTDSLWQGPTGFIHQVVDAALLETLPEYEIYLA
GPPPMVDATVRMLLGKGVPRDQIHFDAFF
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtaccaactcaaaattgaagggcaagcgccagggacctgcggctcagggaagagcctg
ttggtctcagcacttgctaatggtatcggatttccgtacgagtgtgcatcgggaggttgc
ggagtatgcaaattcgagttactcgaagggaatgtccaatcaatgtggccggatgctcca
ggactttcttcgcgagatcgtgagaagggcaaccgccatcttgcatgccagtgcgttgcg
ctctcagacctgcggatcaaagtcgcagtgcaggacaagtacgtcccaacgattccaatc
tcaagaatggaagcggaagttgttgaggtccgggcgctaactcatgacctgctgtccgtg
cgattacgcactgatgggccagcaaatttcctccccggccagttctgcctagtagaggca
gagcagttgccaggcgtggttcgcgcatattcaatggcgaatttaaagaaccccgaaggc
atatgggagttctatattaagagggtacccacaggacgatttagtccttggcttttcgaa
aatagaaaagaaggcgctcgtctatttttgacgggaccaatgggcacatctttcttccgt
ccagggaccggccgaaagagtctttgcattggcggcggtgccgggctctcgtatgcggcc
gctattgcacgcgcctcgatgcgcgaaacagacaagccggtaaagttgttctacggctca
agaactccgcgcgacgctgttcggtggatcgatatcgacatcgatgaggacaagcttgag
gtcgtccaggcagttacggaagacacggatagcctttggcaagggcccactggttttatt
catcaggttgtcgacgcagcgctgcttgaaaccctaccggaatacgaaatttatcttgcc
ggtccaccgcctatggtcgacgctactgtccgtatgctgctcggcaagggtgttccacgc
gatcaaattcattttgacgcatttttctaa

DBGET integrated database retrieval system