KEGG   Poecilia reticulata (guppy): 103457138
Entry
103457138         CDS       T05149                                 

Gene name
pomc
Definition
(RefSeq) pro-opiomelanocortin isoform X1
  KO
K05228  proopiomelanocortin
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
pret04916  Melanogenesis
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103457138 (pomc)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103457138 (pomc)
   04916 Melanogenesis
    103457138 (pomc)
SSDB
Motif
Pfam: NPP ACTH_domain Op_neuropeptide DUF5546
Other DBs
NCBI-GeneID: 103457138
NCBI-ProteinID: XP_017163900
LinkDB
Position
LG2
AA seq 183 aa
MSLAWLLVAVLVVGGARGAASQCWESLSCQDLNSESSVMDCLHACRSDLTAETPLVPGDA
HLSPPPDPAAPQAKRSYSMEHFRWGKPVGRKRRPIKVYTSNGVQEESAEAFPAEMRRRSD
EEEEEEEQLLQEKKDGSYKMKHFRWSGPPAGKRYGGFMKSWEEGRQKPLVTLLKNIINKE
EQM
NT seq 552 nt   +upstreamnt  +downstreamnt
atgagtcttgcgtggctattggtggccgtgctggttgtgggcggagccagaggagcagcc
agccaatgctgggagagtctgagctgccaggatctgaacagcgagagcagcgtgatggac
tgtctccacgcctgccgctctgacctgacggccgagacgcccctggtcccaggtgaygcc
cacctgtcgccgccccccgaccccgccgccccgcaggccaagcgctcctactccatggag
catttccgttgggggaagccggtcggccgcaaacgccgccccatcaaggtctacacgtcc
aacggcgtgcaggaggagtcggccgaggcgttccccgccgagatgaggaggcgcagtgac
gaagaggaggaggaggaggagcagctgctgcaggagaagaaggacggmtcctacaagatg
aagcacttccgctggagtgggccgccagcggggaaacgctatggaggatttatgaagagc
tgggaggaagggaggcagaaaccgctggtcacgctgctgaagaacatcatcaacaaggag
gagcagatgtag

KEGG   Poecilia reticulata (guppy): 103457563
Entry
103457563         CDS       T05149                                 

Definition
(RefSeq) pro-opiomelanocortin-like
  KO
K05228  proopiomelanocortin
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
pret04916  Melanogenesis
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103457563
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103457563
   04916 Melanogenesis
    103457563
SSDB
Motif
Pfam: ACTH_domain NPP Op_neuropeptide
Other DBs
NCBI-GeneID: 103457563
NCBI-ProteinID: XP_008396037
UniProt: A0A3P9MVG6
LinkDB
Position
LG21
AA seq 236 aa
MVCQCWLFMVLMGFMCSSGSGSVCLESSTCNDLSNKNIIQDCLHLCTPETEPEIKPPGVR
GQQENDDFGDPEESHRGDLLLNIILSTLASGGKVPEGDLKAHDDRRRSYAMEHFRWGKPF
GRKRRPVKVFPSALDEEAFPLRARRHLSWNKAESKGGVVKGRHQNKDLLGPRAGFRSRAT
PERKAETYRMSHFRWGSPPASKQNNGFGKLWEEKPREKLTKLFKNILVKDVKMIMG
NT seq 711 nt   +upstreamnt  +downstreamnt
atggtgtgtcagtgctggttgtttatggttctgatgggatttatgtgcagctctgggtct
ggctcggtgtgcttggagagctctacatgcaacgacttgagcaacaagaacataatacag
gactgccttcacctctgcacccccgaaaccgagcctgaaatcaagccacccggggtcaga
ggtcagcaggagaatgacgactttggtgatcctgaggagagccacaggggtgacctgctg
ctcaacatcattctctccactctggcttctggaggcaaagtaccagagggagatctgaaa
gcccacgacgaccggcgccgctcttacgcaatggagcatttccgttgggggaagcccttc
ggcagaaagcgccggcctgttaaagtgttcccctccgctctggatgaggaggccttcccc
ctgcgggcgcgcaggcacttgagttggaacaaagctgaatcaaagggaggcgttgttaaa
ggaaggcatcagaataaggatctgctcgggcccagagccgggttcaggtctcgggccacg
ccggagagaaaagccgagacctacaggatgagtcacttcagatggggcagcccgcctgca
tccaaacaaaacaatggcttcgggaagctgtgggaggagaaacctcgggaaaagctgacc
aagttattcaagaacattttagtgaaggatgtgaaaatgataatgggctaa

KEGG   Poecilia reticulata (guppy): 103472811
Entry
103472811         CDS       T05149                                 

Definition
(RefSeq) pro-opiomelanocortin-like
  KO
K05228  proopiomelanocortin
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
pret04916  Melanogenesis
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103472811
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103472811
   04916 Melanogenesis
    103472811
SSDB
Motif
Pfam: Op_neuropeptide ACTH_domain NPP DUF4079 FAM110_C
Other DBs
NCBI-GeneID: 103472811
NCBI-ProteinID: XP_008420874
UniProt: A0A3P9QAL3
LinkDB
Position
LG11
AA seq 209 aa
MHPVLLLVVAVSVGGARAALSRCWERQRCQELVSESSMMECFQLCGLDPHEMTTILSXDH
LQHPPSSVFLSPSPSSSSSQAKHSYSMEHFRWGKPLGRKRHPAKIPAGKKVDGDSAEIFP
GELRWWELSREKMTAEDEETQDEAEEASNEHHDKKDIPYKMKHFRWSGPVVGKRYGGFMK
SWQEHSKRPLITLFRNVINKEGEEEKRAK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgcatcctgtgttgctattggtggttgcagtgtcggtgggcggggccagagcggcgctc
agtcgctgttgggagcgccagagatgccaggagctcgtctctgagagcagcatgatggag
tgtttccagctctgtggacttgaccctcatgagatgaccaccatccttagcrgtgatcac
cttcagcatcctccgtcatctgtctttctttctccttcaccctcttcctcctcctctcaa
gccaaacactcctactccatggagcatttccgctgggggaagcctcttgggagaaagcgt
catccagcgaaaatccccgcaggcaaaaaggtggatggggactcagctgagattttccct
ggagagctgaggtggtgggagctttccagggaaaaaatgacagctgaggatgaggagaca
caagacgaagcagaggaggcctccaatgagcatcatgataaaaaagacatcccgtacaag
atgaagcacttccgctggagcggccctgtggtgggcaaacgctacgggggcttcatgaag
agctggcaggagcacagcaagaggccgctcatcacactcttcagaaacgtcatcaacaaa
gaaggagaggaggagaaragagcaaagtga

DBGET integrated database retrieval system