KEGG   Poecilia reticulata (guppy): 103457398
Entry
103457398         CDS       T05149                                 

Gene name
nfkbie
Definition
(RefSeq) NF-kappa-B inhibitor epsilon
  KO
K05872  NF-kappa-B inhibitor epsilon
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103457398 (nfkbie)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103457398 (nfkbie)
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    103457398 (nfkbie)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4 DUF3447 GILT
Other DBs
NCBI-GeneID: 103457398
NCBI-ProteinID: XP_008395712
UniProt: A0A3P9NS47
LinkDB
Position
LG21
AA seq 343 aa
MSRDGCSKEDLQEDIRMDSGIESYTSIVTSEEPREPSSDFSGPRDKFSTGEERLDSAYTS
SSITVESLSDIVEGCTISSAEDVQAKMPELSEQDNLLTTITEDGDTLLHLAIIHEEIFIS
QELIQLFPKEALDIQNNLYQSPLHLATYLNLTHVVTTLMKKGASLELQDQDGNTPLHVAC
QHGQLECVTEMTRDLPPSSLAPVLQTQNWRGLTCLHLSALNKQHHIMKLLMKKKANLNIQ
EGTAGKTALHLAVELHDMALVKLLLKEGANVDAPMFNGCTPLHLAVGRQDAQIADLLCQF
GADKMLRNMEDETALDLADGNNDILALFPFDDIQISGRSVVSF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgtcgcgcgacggttgtagcaaagaggacctgcaagaggacatccgcatggactcgggc
attgagtcttacacctccatagtaacttcagaggagccccgggaaccgagcagcgacttc
agcgggccgagggacaagttttccaccggggaggagcgcctggactcagcctacacgtcc
tcatccatcacggtggagagcctgtcggacatcgtagagggttgcactatctccagcgcc
gaggatgtgcaagcaaagatgcctgaactttcagaacaagataatttactcacaactatt
acagaagatggagacacactcctccacctagccatcatccatgaggaaatattcatctct
caagagttgatacagctgttcccaaaagaagccctggacatccagaacaatttatatcag
agcccgctgcacctggccacctatctgaacctgacgcacgtggtgacgaccctgatgaag
aagggggccagcctggagctgcaggaccaggacgggaacacgccgctccatgtggcgtgc
cagcacgggcagctagagtgtgtaacagaaatgaccagagaccttcctccgagctcgctg
gcaccagttctgcagacccagaactggagaggtcttacctgtcttcacctgtcagcgctg
aacaagcagcatcatatcatgaagctcctgatgaaaaaaaaagcaaatcttaacatccag
gagggaactgccggcaaaacggctctccacctcgccgtcgagctgcacgacatggcgttg
gtgaagctgctgcttaaggagggggccaacgtggacgctcccatgttcaacggctgcacg
ccgctgcacctcgccgtaggcaggcaagacgcgcaaatcgccgacctcctttgccagttc
ggcgccgacaaaatgctgcgaaacatggaagacgagacggcgctggatctggccgacgga
aacaacgatattctggcgctgtttccatttgatgacatccagatctccggaaggtcggtg
gtgtcgttttga

KEGG   Poecilia reticulata (guppy): 103457805
Entry
103457805         CDS       T05149                                 

Definition
(RefSeq) NF-kappa-B inhibitor alpha-like
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04210  Apoptosis
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103457805
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103457805
   04621 NOD-like receptor signaling pathway
    103457805
   04622 RIG-I-like receptor signaling pathway
    103457805
   04623 Cytosolic DNA-sensing pathway
    103457805
   04625 C-type lectin receptor signaling pathway
    103457805
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103457805
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103457805
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103457805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103457805
   04131 Membrane trafficking [BR:pret04131]
    103457805
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    103457805
Membrane trafficking [BR:pret04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103457805
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_3 Ank Ank_5
Other DBs
NCBI-GeneID: 103457805
NCBI-ProteinID: XP_008396440
UniProt: A0A3P9Q088
LinkDB
Position
LG21
AA seq 301 aa
MAVHAMHGQMDYNLDSKQGKMLEDRLDSGVDSLKDETLMIEDFKDLTVRCKEETTEEWEP
WRDAVTEDGDTLLHLAIIHEATEHALQMIQLSRNHSFLNKQNHQRQTALHLAVITEQPKL
VDCLLKAGADPLLADNSGNTALHIACKRGSMACFGVITQNCQRHLTSVLSVPNYSGHNCL
HLASINGYVSLVESLVQLGANINEQEPCSGRTALHLAVDLQNPTLVRCLLDLGAEVNCQN
YGGFTPYHLTYGRQNDEIRCQLYERTALELRALPESESDDSDMEDLELLEDEIYDDIVFG
K
NT seq 906 nt   +upstreamnt  +downstreamnt
atggccgttcacgcaatgcacggacaaatggattataacttggacagcaagcaggggaaa
atgctggaggaccgcctggacagcggcgtggactccttaaaggacgaaaccctgatgatc
gaggactttaaggacctgactgtgagatgcaaggaggagaccacggaggagtgggagccg
tggagggacgcggtgactgaggacggagacacgctgctccacttggccatcattcatgaa
gccactgaacatgcccttcagatgatccagctctccagaaatcactctttcctcaacaaa
cagaaccaccaaagacagactgccctccacttggcagtgatcaccgagcagcccaagttg
gtggactgtctcctgaaggccggcgctgacccgctgctggctgacaacagcggcaacacg
gctctccacatcgcctgcaaacgcggctccatggcgtgcttcggcgtcatcacccagaac
tgccaacgccacctcacctccgttctgtccgtccccaactacagtggacacaactgtctc
cacttggcgtccattaatggctatgtttccttggtggaaagcctcgttcagctgggagca
aacatcaatgaacaggaaccctgcagtggacggacagcgctccacttggctgtcgatctg
cagaaccccacgctagtccgatgcctccttgacctcggcgcagaggtcaactgccagaac
tatggaggcttcacgccataccaccttacgtacgggcggcagaacgatgagatccgctgc
cagttgtacgagcggacggcgctggagctgagggcgctacctgagagcgagtcagacgac
agcgacatggaggacctggagttgctggaggatgagatctatgacgacatagtgttcggg
aagtag

KEGG   Poecilia reticulata (guppy): 103458779
Entry
103458779         CDS       T05149                                 

Gene name
nfkbia
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04210  Apoptosis
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103458779 (nfkbia)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103458779 (nfkbia)
   04621 NOD-like receptor signaling pathway
    103458779 (nfkbia)
   04622 RIG-I-like receptor signaling pathway
    103458779 (nfkbia)
   04623 Cytosolic DNA-sensing pathway
    103458779 (nfkbia)
   04625 C-type lectin receptor signaling pathway
    103458779 (nfkbia)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103458779 (nfkbia)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103458779 (nfkbia)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103458779 (nfkbia)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103458779 (nfkbia)
   04131 Membrane trafficking [BR:pret04131]
    103458779 (nfkbia)
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    103458779 (nfkbia)
Membrane trafficking [BR:pret04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103458779 (nfkbia)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 103458779
NCBI-ProteinID: XP_008398057
LinkDB
Position
LG22
AA seq 386 aa
MRSAFIIQVWAEIPSLALLCVCEVILVVSLVEIPHLCANSARSAARYTQRAFTGCSSHTL
SHSTTRTSRTNMDLHRTSILNQMDYNRESKEGKAAQSTEERLDSGVDSLKEEEYQAVAEE
LHRLQLESDRQQAAARTEEPLQEWQTQTTDEGDTLLHLAIIHEAKDYIKQMIDLSKNTPF
LNAQNDLRQTPLHLAVITNQPNVCSSLLASGCDPTLVDNSGDTPLHIACRHGNLYCFSVI
TQNCRLEHLHTAMAACNYNGQNCLHLASVHGFLSLVEKMVDLGADINAKEQHNGRSSLHL
AVDQQNLALVKLLLRKGADPNLLSSGGHTPFHLTYGLDNCDIQKELFPVTHPDLRDLSES
ENSGEESSEEESDEEGMYDDIQWNGH
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgagaagcgcttttattattcaagtctgggcagaaatcccctctctggctctgctgtgt
gtttgcgaagttattctagttgtcagtttggtggaaatcccccacctatgtgctaactcc
gcccgctctgcagccagatacacgcagagggcatttacaggctgcagctcacacacactt
agccacagtacaactaggacttccagaaccaacatggaccttcaccggaccagtatatta
aaccaaatggattacaatcgggagtctaaagaagggaaggcggcccagtcgacggaggag
cggctcgacagcggcgtggactcgctgaaggaggaagagtaccaggctgtggcggaggag
ctccatcggctccagctggagagtgatcgccagcaggccgcagctcggaccgaagagccg
ctgcaggagtggcagacgcagactacagacgagggagacacgctgctccacctggccatc
atccacgaagcaaaggactacatcaaacaaatgattgacctttcaaagaacacacctttc
ctcaatgcacagaatgacctgagacagactcctctccacttagcagtaataacaaaccag
ccgaacgtgtgctccagtctcctcgcgtccggctgcgaccccacgctggtggacaacagc
ggcgacacgcctcttcacattgcctgtcgccacggtaacctgtactgcttcagcgtcatc
acacagaactgcaggttggagcacctgcacacggcgatggctgcctgcaactataacggt
cagaactgcctccacctggcttcggttcacggtttcctctcgctggtggagaaaatggtg
gacctcggagcggatatcaacgccaaagagcagcacaacggccgcagctcgctgcatctt
gccgtggaccagcagaacctcgctctggtcaaactcctcctgaggaaaggagcagacccc
aacctcctgtcgtccgggggacacactcccttccacctcacctacggtttggacaactgc
gacatccagaaagagctgttcccggtgacccatccggacctgagggacctctccgaatca
gaaaacagcggagaggagtcgtcggaggaggagtcggacgaagagggaatgtacgacgac
attcagtggaacggacattag

DBGET integrated database retrieval system