KEGG   Poecilia reticulata (guppy): 103458231
Entry
103458231         CDS       T05149                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1-like isoform X2
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103458231
Transporters [BR:pret02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   103458231
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    103458231
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 103458231
NCBI-ProteinID: XP_008397106
UniProt: A0A3P9NUX7
LinkDB
Position
LG22
AA seq 483 aa
MASKERHLTATLLASILGAVLGPLQIGYHTGNVNAPARIIEEFFNSTWRARHNQSMTDHS
LTLLWSLSVSIKDFGALLGSLGVKHLADSYGRRNSILIANCLSVAAACVMFASKASGSFE
VLILGRLVFGLFCGLVMSLNQLYIQEVSPTNLRGAFATLNQVSLASGILIGMVAGLETTL
GTKSNWAMMLSLSLIPALTQYLVLPFCPESPRYLLMNQGEERKAETXLLKLRGHADKVSS
ELEEMKDEAAHILTRFTVRDFLQKRSYRQPILIVLLVNLGSQLSGFNAIINYSTKMFQAK
FDGAKYLTLGVGVVNVIFTLVAFILMERAGRRKLLLTGFLSIGVCNFLMTIVDSVLHLVP
ELRSLQVLLVFCVVSAYELGPGPISWFIAAELFDQPGRPIAMALTSMVNWGGKFVLALLF
PPLLKICGAYVYLIFTAVALLAFAVTWLRLPETKGRTFDDIAEEFRGAEGIPLHNSGGFN
TFT
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggcatccaaagagagacatctgacagcaacactcctggcctccatcctgggagccgtg
ctcggccccctgcagatcggctaccacactggcaacgtcaacgctccggccaggatcatc
gaagagttcttcaacagcacatggagagccagacacaaccagtcgatgacggatcacagc
ctgaccctgctgtggtcgctttccgtcagcatcaaggactttggagcgttgctgggatct
ctgggggttaaacacytggcggattcatacggcagacgaaattccatcctgatcgccaac
tgtctgtcagtggcagcggcgtgtgttatgtttgcctctaaagccagcgggtcgttcgag
gttctaatcctgggacggctggtgtttggcctgttctgcggtcttgtgatgagtctaaac
caactctacatccaggaagtgtcccctaccaatctgagaggagcctttgccacactcaac
caagtgtcattagcctctggcatcctgatagggatggtggctggtctggaaacaacgctg
ggcacaaagagcaactgggcgatgatgctgtccytgtctctcatcccggccctgacgcag
tatctggttctgcctttctgcccagaaagccctcgctacctcctaatgaaccagggagag
gagaggaaagcagaaacckccctgttgaaactgcgaggccacgctgacaaagtgtccagt
gagctggaggagatgaaggacgaggctgcacacatcctgacccgcttcaccgtccgggat
ttcctccagaaacggagctacaggcagccgatcctcatcgttctcctcgtcaacttaggc
agccagctttctggattcaatgcaattatcaactactccactaaaatgttccaggccaag
ttcgatggggccaaatatctgactctaggtgtgggagttgtcaatgtcatcttcactttg
gttgcattcatcttgatggagcgggccgggaggaggaagctgttgctgactggtttcctc
tccataggagtttgtaatttccttatgaccatagtggactctgttctgcacctggtccca
gagctgcggagcctgcaggtcctgctggtgttctgcgtggtctcggcctacgagctgggc
cccggccccatctcctggttcatcgccgccgaactgttcgaccagcccggtagaccgatc
gccatggctctcaccagcatggtcaactggggagggaagttcgtcctcgccctcctcttc
cctccgctgctgaaaatctgcggggcctacgtctacttgattttcacggctgtggctctg
ctcgccttcgccgtcacgtggctccgcctcccggagaccaaaggtcgcacgttcgacgac
attgcggaggagttcagaggagcggagggaatcccgctgcataacagcggcggattcaac
actttcacctga

KEGG   Poecilia reticulata (guppy): 103464733
Entry
103464733         CDS       T05149                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1-like
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103464733
Transporters [BR:pret02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   103464733
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    103464733
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 103464733
NCBI-ProteinID: XP_008407267
UniProt: A0A3P9PCU0
LinkDB
Position
LG5
AA seq 491 aa
MDSGKQITFPLLMSVGTAVIGSLQFGYNTGVINAPQKIIENFINETYRERYQEPISESQL
TAIWAISVSIFSVGGIFGSFSVGFFVNRLGRRNSMLIANILAFIAAALMGFSKMASSWEM
LIIGRFVVGLYSGLSTGFVPMYVGEVSPTGLRGALGTLHQLGIVVGILIAQIFGLEMIMG
NAEYWPLLLSFLFIPAVIQSILLPLCPESPRFLLINKNEENKAKTILKKLRGATDVSSDM
QEMKEESRQMMREKKVTILELFRSPLYRQPIIIAITLQLSQQLSGINAVFYYSTRIFEKA
KVPQPVYATIGAGVVNTAFTVVSLFVVERAGRRTLHLLGLMGMAVSAVLMTIALALLEQL
YWMSYVSIVAIFAFVAFFEMGPGPIPWFIVAELFSQGPRPSAIAVAGFSNWTSNFIVGLG
FPYVEQVCGPYVFVIFTVLLLFFFIFTYFKVPETRGRTFDDIAAGFRQTAGGGAEKHSPE
ELNSLGADSQL
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggactcgggaaagcaaataacgttccccttgttgatgagcgttggcactgcggtgatc
ggctccctgcagttcggatacaacacaggtgtcatcaatgctccacagaagataattgag
aatttcatcaatgagacgtatagagaacgttaccaggagcccatctccgagagccagctc
acagcaatctgggccatttctgtgtccatcttctctgttggaggcatttttggttccttc
tctgttggattctttgtcaaccgtttgggaaggaggaactccatgctcatagccaacatt
ttagccttcatcgcggctgctctgatgggtttttcaaagatggccagctcttgggaaatg
ctcatcattggtcgttttgtagtgggtctctactccggcctctccactggttttgtgccc
atgtatgtcggcgaagtctccccgacaggcctgcgaggcgcattgggcacgctgcaccag
ctgggaatcgtcgtaggcatcctcattgcacagatattcgggttggagatgatcatgggt
aacgctgagtattggccgctgctgctgagcttcctcttcatcccggctgtgatacagtcc
atcctgctgccgctgtgcccagagagcccccgttttctgctcatcaacaagaatgaagag
aacaaagccaaaacaatcctgaagaagctcagaggggcaacagatgtgagttctgacatg
caggagatgaaggaggaaagccggcagatgatgagggagaaaaaagtgaccatcctggag
cttttccgctctccgctctatcgccagcccattattatcgccatcaccctgcagctctcc
cagcagctctctggaatcaatgctgtcttctattactccacacgcatctttgagaaagcc
aaagttccacagccagtgtatgccaccatcggagctggtgttgttaacactgctttcact
gtagtttctctgttcgttgtggagcgtgcaggacgcagaactttgcacctgctgggactg
atgggcatggccgtgtctgccgtgctgatgaccatagccttggctctgctggagcaactc
tattggatgtcctatgtgagcattgtggccattttcgcctttgtggcgttctttgagatg
ggccccggtcccatcccctggttcatcgtggcggagttgttctctcagggacccaggccg
tcggccatcgctgtagctggtttctccaactggacatccaactttatagtgggactgggc
ttcccgtatgtagagcaagtctgcggcccctacgtgtttgtcatctttactgtgctgctg
ctcttcttcttcatcttcacgtacttcaaagtgccagagacccggggccggacgtttgac
gacatcgccgccggcttccgccagacggccggcggtggagcagagaagcactcgccggag
gagctgaacagcctgggagcggactctcagctctga

KEGG   Poecilia reticulata (guppy): 103466997
Entry
103466997         CDS       T05149                                 

Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1-like
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103466997
Transporters [BR:pret02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   103466997
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    103466997
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF2127
Other DBs
NCBI-GeneID: 103466997
NCBI-ProteinID: XP_008411226
UniProt: A0A3P9NVE6
LinkDB
Position
LG7
AA seq 493 aa
MECSGKVTPQLMLAVGTAVIGSLQFGYNTGVINAPQNIIESFYNTTWISRFSEPISQSTL
TALWSFSVAVFSVGGMFGSFSVGLFVNRFGRRNSMLMANVLVFLAAVFMGFSKLAASFEM
LIIGRFIVGMYSGLSTGFVPMYVEEISPTSLRGALGTLHQLGVVIGILMAQIFGIESILG
NASLWPLLMGFTLLPALLQCALLPFCPESPRYLLINCNEESKACSVLIKLRGTDEVSEDI
QEMREESQKMMREKKVTIPELFRSPIYRQPILVAIMLQLSQQLSGINAVFYYSTGIFERA
GVSQPVYATIGAGLVNTAFTVVSLFVVEHVGRRPLHLIGLMGMAVSAVFLTVAMALLDQL
SWMSYVSIVAIFSFVAFFEIGPGPIPWFIVAELFSQGPRPAAIAVAGFCNWSANFIVGMS
FQYVEQLLGPYVFIIFTVLLLGFFVFTYFKVPETKGRTFDEIAAGFRHSSGQGTEKYSAP
EEFNTLKGDDPDL
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggagtgcagcgggaaggtgacgccccagttgatgctggcagtggggacggctgtgatc
ggctctctgcagtttggctacaacactggtgtcatcaacgcacctcagaatatcattgag
agcttctacaacacaacatggatcagcaggttttcagaacccatttctcagagcaccctg
acagctctgtggtctttttctgtggccgtcttctccgtgggaggaatgttcggctccttc
tctgtcggcctttttgtcaaccgctttggcaggaggaactccatgctcatggccaatgtg
ttagtcttccttgctgctgtgtttatgggcttcagcaaactggcagcttcctttgagatg
ctcatcattggacgttttatagtgggtatgtactctggcctctctacgggrtttgtaccc
atgtatgttgaggaaatctctccaacgtctcttcgtggagccctgggcactctgcatcag
ctcggtgtggtgattggcatcctcatggcccagatctttgggattgaatccatcttgggg
aatgcgtccctgtggccactgctgatggggttcactctgctgccggccttgctgcagtgt
gctctgctgccgttctgtccagagagcccccgctacctcctcattaactgcaatgaagag
agcaaagcctgcagcgtcctaataaagctgcggggcaccgacgaggtgagtgaggacata
caggagatgagggaggagagccagaagatgatgagagagaagaaagtgaccattcctgag
ctgtttcgctctcccatctaccgccagcccatcttggttgccatcatgcttcagctgtcg
cagcagctgtctggaatcaacgctgtattttactactctactgggatctttgagcgagca
ggagtttcacagcctgtgtatgccaccattggtgctgggttggtcaacacygcctttact
gtcgtttctctgtttgtggtggagcatgtgggccgacgacctcttcatctcatcgggttg
atggggatggcggtgtctgctgtgtttttaactgttgccatggctctgctggaccagctc
agctggatgtcctatgtcagcatcgtggccatcttcagctttgtagccttttttgaaatc
ggccccggccccatcccgtggttcattgtagctgagctcttcagccaggggccccggccc
gctgccattgcagttgctggtttctgcaactggtctgccaacttcatagtgggaatgagc
ttccagtatgttgagcaactccttggtccctatgtcttcatcatcttcactgttctgctg
cttggcttcttcgtcttcacttacttcaaagtacccgagacaaagggtcgcacctttgat
gagatcgcagcaggtttccgccactcctctggtcaggggactgagaagtattcagctcca
gaagaattcaacacgctcaagggggatgaccctgacctgtag

KEGG   Poecilia reticulata (guppy): 103480459
Entry
103480459         CDS       T05149                                 

Gene name
slc2a4
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 4
  KO
K07191  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 4
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103480459 (slc2a4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103480459 (slc2a4)
   04920 Adipocytokine signaling pathway
    103480459 (slc2a4)
Transporters [BR:pret02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   103480459 (slc2a4)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    103480459 (slc2a4)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_2_3
Other DBs
NCBI-GeneID: 103480459
NCBI-ProteinID: XP_008433632
UniProt: A0A3P9PDF3
LinkDB
Position
LG18
AA seq 503 aa
MPAGFQQLGGETVTGTLALSVFTAVLGSLTFGYNIGVINAPQKIIEEDYNATWIHRYGEP
IPSGTLTSLWSLSVAIFSIGGMLSSFCVGFISEWLGRRKAMLANNLFAFVAGSLMGMSKV
CRSFEMMILGRFVIGAYCGLASGLTPMYVGEIAPTSLRGALGTLHQLAIVTGILIAQILG
LEMLLGSEDLWPVLLGLTVVPTVLQMGLLPFCPESPRFLYIVRSQEHHAKSGLRRLTGRQ
EVGDMLAEMKEEKRRMDMERKVSILELFRSPLYRQPIVISILLQLSQQLSGVNAIFYYST
SIFMKAGVQSPVYATIGAGVVNCAFTVVSLFLVERMGRRTLHMLGLAGMCISAIIMTIAL
ALLDSIPWMSYISMLAIFGFVAFFEVGPGPIPWFFVAELFSQGPRPAAMAVAGFSNWTAN
FIIGMGFQYVADLCGPYVFLIFAVLLLFFLIFTFFRVPETRGKTFDQIAANFNQHSAAGM
MDMDMELDKPSTELDYLGDESIN
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgccggccgggtttcaacagctcggaggggagacggtgacgggaaccctcgctctatca
gtcttcactgctgttctgggatcgctgacgttcggctacaacatcggagtcatcaatgca
ccacagaagatcattgaggaggactacaatgcaacgtggattcatcggtacggagaacca
atcccctcagggaccctcacctccctctggtcgctgtctgtggccatcttctccatcggg
ggcatgctctcctccttctgcgtgggcttcatctcagagtggctgggcaggaggaaagcg
atgctcgccaacaatttgttcgccttcgttgctgggagtctgatgggaatgtctaaggtc
tgtcgctcctttgaaatgatgattctgggacgtttcgtcattggggcctactgtggactt
gcgtctggtttgacgcccatgtacgtgggggagatagctcctacaagtcttcgaggtgca
ctcggcacattgcaccaactggccatagtcactgggattcttatagcacagattctgggt
ctggagatgttgctgggcagtgaggacctttggcccgttctgctgggtttgaccgtggta
ccgactgtactgcagatgggtctgctgcccttctgccccgagagtcctcgattcctctac
atcgttcggagtcaggagcatcacgccaagagtggcttgaggaggttaacaggccgacag
gaggtgggtgacatgctagcagagatgaaggaggagaaaaggaggatggacatggagagg
aaagtctccatcctagagctcttccgctcgcctctttatcgccagcccattgtcatttcc
atcctgctgcagctctcccagcagctctctggagtcaatgcaattttctactactccacc
agtatcttcatgaaggcaggagtccagagtccggtctacgccacaataggagccggagtt
gtaaactgtgctttcactgtggtctcgctgttcctcgtggagcggatgggtcggcggaca
cttcacatgttgggtttggcaggaatgtgcatttctgccattatcatgaccatagctctg
gctttactggacagcattccttggatgagctacattagcatgctagctatctttggcttt
gtggccttctttgaggtgggtccaggtcccattccttggttctttgtagctgagctgttc
tctcaaggcccgaggccggctgccatggctgtggcgggcttctccaactggaccgccaac
ttcatcatcggcatgggtttccagtacgttgcggatctctgtgggccttacgtgttcctg
atcttcgcagtgctgctcctttttttcctcatctttacgttctttcgggtgccagagacc
cggggaaagacattcgaccagatcgcagccaactttaatcagcactcggcggctggcatg
atggatatggacatggagctggacaagcccagcacggagctggactacctgggcgatgaa
agcatcaactga

DBGET integrated database retrieval system