KEGG   Poecilia reticulata (guppy): 103458269Help
Entry
103458269         CDS       T05149                                 

Gene name
ganc
Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00052  Galactose metabolism
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103458269 (ganc)
   00500 Starch and sucrose metabolism
    103458269 (ganc)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103458269 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 DUF5110
Motif
Other DBs
NCBI-GeneID: 103458269
NCBI-ProteinID: XP_017157888
LinkDB All DBs
Position
LG22
AA seq 489 aa AA seqDB search
MAAKREPIISVVPNDEEKEKFKKSENVAFYRRQIQGPNLKYRLLLDSLVLTEKGARFELL
EDGTKTRLLLSLTPCKNDTVRIVIDEIWPIKTRYRVPDVLTGEPPSEQGKLVQRHHREGG
ELGSTPSLFVWNDMNEPSVFNGPEQTMPKDAVHHGGWEHRELHNLYGFYQHMATADGLMS
RSGGSERPFVLTRSFFAGSQRLGAIWTGDNVATWEYLKISLPMVLTLNLTGIVFCGGILL
PFCYFKEISLLXASVASLLGVGIYRIAYYERPLWVEFPEEESTFTEDNQYMIGGALLACP
VTEQGAQTVKVLLPGSDEIWYDISSAKAHKGGKSLSLPVNLDTVPVFQRGGSVVCRSTGS
GTCTVDYQKMPLDVTVALNSQASADGELYLDDGHSFEYRDKKAFSLRRVSMASGRLLCRS
ASEEGRFDCDTVVQSVSIMGVKSKPTTVNVHVPGAKSISASFEFLEACCTLRLNNLNVRV
XTDWDIQIN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaagagagaacctattattagtgttgtccctaatgatgaggagaaggagaaa
ttcaaaaaaagtgagaatgttgctttttacaggcgacagatccagggtccaaacctgaaa
tacagacttcttttggattcccttgtcctcacggagaagggcgcacgttttgagcttttg
gaagatggcacaaagaccagactgcttctttctttgacaccttgcaaaaacgacaccgta
aggatcgtaatagacgagatctggcccatcaaaacccgttacagagttccagatgtgttg
accggggaacctcctagtgaacaaggaaagctggtgcaacgccaccacagggaaggaggt
gaattgggatckacgccgtcgctgtttgtgtggaacgacatgaacgagccgtccgtcttc
aacgggccagaacagacgatgccgaaggacgcggtgcaccatggaggctgggagcatcgg
gagctgcacaacctgtatggcttctaccagcacatggccacggcggacggtttgatgtcc
cgctcaggaggctcggagaggccgtttgttctcacacgctccttctttgctgggtctcag
aggctgggcgcaatatggaccggtgacaacgtagccacctgggagtatctgaagatttca
ctgccaatggttttgaccctgaacctgacaggcattgtattttgtggaggtattctgtta
ccattctgttacttcaaagaaatctcattacttygcgcatcggttgcatctcttttaggg
gtgggcatttatcgtatcgcttattatgaaagacctctttgggtggagttcccagaagag
gagagcaccttcaccgaggacaaccaatacatgattgggggagccctgctcgcctgtcct
gtgacggaacaaggcgctcagacagtcaaagtcttacttcccggctccgacgagatttgg
tacgacatcagctctgcgaaggcgcacaaaggaggaaagagtttgagtcttcctgtcaac
ctggacacagttccagtgtttcagcggggcggctcagtggtctgcaggtcaacgggaagt
ggcacctgtacggtcgactaccagaagatgcctctagatgtcactgtggccctaaactcc
caggccagtgcagacggagagctgtacctcgacgacggccactccttcgagtaccgtgac
aaaaaggccttctccctgcggcgggtcagcatggcgtckggccgtctgctctgtcgttcg
gccagtgaagaggggaggtttgactgtgacacygtcgttcagtcsgtttccatcatggga
gtgaagagcaagccgaccacggtgaacgtccacgtcccaggtgctaaatccatctctgct
tcctttgagttcctggaagcctgctgcacgctcagactgaacaacctgaacgtcagagtg
aygacrgactgggacatacagatcaactga

DBGET integrated database retrieval system