KEGG   Poecilia reticulata (guppy): 103458546
Entry
103458546         CDS       T05149                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04218  Cellular senescence
pret04261  Adrenergic signaling in cardiomyocytes
pret04370  VEGF signaling pathway
pret04371  Apelin signaling pathway
pret04510  Focal adhesion
pret04620  Toll-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103458546 (akt1)
   04012 ErbB signaling pathway
    103458546 (akt1)
   04370 VEGF signaling pathway
    103458546 (akt1)
   04371 Apelin signaling pathway
    103458546 (akt1)
   04068 FoxO signaling pathway
    103458546 (akt1)
   04150 mTOR signaling pathway
    103458546 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103458546 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    103458546 (akt1)
   04218 Cellular senescence
    103458546 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103458546 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103458546 (akt1)
   04625 C-type lectin receptor signaling pathway
    103458546 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103458546 (akt1)
   04920 Adipocytokine signaling pathway
    103458546 (akt1)
   04914 Progesterone-mediated oocyte maturation
    103458546 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103458546 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103458546 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103458546 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103458546 (akt1)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103458546 (akt1)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103458546 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 103458546
NCBI-ProteinID: XP_008397667
UniProt: A0A3P9QC75
LinkDB
Position
LG22
AA seq 473 aa
MTNVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVAEGLHKQEEERMDS
SPEPMDMEVYLTKPRQKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDIR
FPRTLGPEARSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFAGINWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTGQTITITPPGQDDSMESFDSERRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaccaatgtggtgatcgtcaaggagggatggctgcataaaagaggagaatacatcaag
acctggaggccgaggtattttctcctcaagagtgacggtacattcattggttacaaagaa
cgaccacaagatgttgaccagctggaaacccccttaaataacttttccgttgcacagtgc
cagctgatgaagacggaacgacccaagcccaacacatttatcatccgctgcctgcagtgg
accactgtcatcgagcgtaccttccacgtggagacccccgaggaaagggaagaatggacc
aaagccatccaggcagtggctgaaggccttcataaacaagaagaggagaggatggactcc
tctccagagcccatggacatggaggtctacctgaccaaacccagacagaaagtgactatg
catgactttgaatacctcaaactcctgggaaaaggcacttttggcaaagttattctggta
aaggagaaggccacaggacgctactatgccatgaagatcctaaagaaggaggtgatcgta
gcaaaagatgaagtggcacacacactcacagagaacagggtcctccagaattcaaagcat
ccgttcttgactggactgaaatactccttccagactcatgaccgcctgtgttttgtaatg
gagtacgcaaacggtggtgagcttttcttccatctgtcaagagaccgggtattttcagaa
gagcgggcacggttctatggtgcagagatagtgtcagcgctggattacctacacgctgag
agaaatgtggtttatagagatctcaagctggaaaacctcatgctggataaagacggacac
ataaagatcacagattttggtctctgtaaggaggggatcaaagacggagccactatgaaa
actttctgcgggacgccagagtacctcgcacctgaggtcctagaagacaatgactacggc
cgtgctgtggactggtggggtctgggcgtggtgatgtatgagatgatgtgcggccggctg
ccgttttacaaccaggatcacgagaggctgtttgagctcatcctcatggaagacatccgt
tttcctcggactctcggccctgaggcgcgctcgctgctctccggtctccttaagaaggac
ccaatgcaaaggttaggcggagggcctgatgatgccaaggagatcatgcagcacaaattc
tttgctgggataaattggcaagatgtctatgaaaagaagcttgtcccgccgtttaagccc
caagttacctcagagacagacacaagatattttgacgaggagttcacaggacaaaccatc
accatcacgccacccggacaagatgacagcatggagtctttcgacagcgagcgacgaccc
cacttcccacagttctcctactctgccagtgggacagcctaa

KEGG   Poecilia reticulata (guppy): 103470003
Entry
103470003         CDS       T05149                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04218  Cellular senescence
pret04261  Adrenergic signaling in cardiomyocytes
pret04370  VEGF signaling pathway
pret04371  Apelin signaling pathway
pret04510  Focal adhesion
pret04620  Toll-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103470003
   04012 ErbB signaling pathway
    103470003
   04370 VEGF signaling pathway
    103470003
   04371 Apelin signaling pathway
    103470003
   04068 FoxO signaling pathway
    103470003
   04150 mTOR signaling pathway
    103470003
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103470003
  09143 Cell growth and death
   04210 Apoptosis
    103470003
   04218 Cellular senescence
    103470003
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103470003
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103470003
   04625 C-type lectin receptor signaling pathway
    103470003
  09152 Endocrine system
   04910 Insulin signaling pathway
    103470003
   04920 Adipocytokine signaling pathway
    103470003
   04914 Progesterone-mediated oocyte maturation
    103470003
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103470003
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103470003
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103470003
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103470003
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103470003
Protein kinases [BR:pret01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103470003
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 103470003
NCBI-ProteinID: XP_008416332
UniProt: A0A3P9Q9X8
LinkDB
Position
LG1
AA seq 479 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVAESLAKQEEEGILCS
PTSQIENVNEEEMDTSISHYKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFGTVDWQDVYDKKLVP
PFQPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgaccagaacgtcgtcaaggaaggctgggtccagaaaagaggcgaatacatcaag
aactggcgaccacgttactttctgctcaagacagatggctccttcatcggctacaaggac
aaaccgcaggactcggacctggcctatccgctcaacaacttctctgtagcaaaatgtcaa
ttgatgaagacagaacgacccaaaccaaacaccttcatcatccgctgcctgcagtggacc
accgtcatcgagaggacttttcatgtcgacactcctgatgagagggacgagtgggccgag
gccatccagatggttgcagaatcgctggctaaacaggaggaggaaggcatcctgtgcagc
cccacttcccagattgagaacgttaatgaggaggagatggacacgtccatcagtcactac
aaacgaaagacaatgaatgactttgactatctgaagcttctgggtaaaggcacgtttgga
aaagtcattctagtgagggagaaggcgagcggcacctactatgccatgaagatcctgaag
aaggaagtcattatagccaaggatgaagttgctcatacgctcacagaaagtagagtatta
aaaaacactcggcatccgttcctaacgtctttgaagtactcgttccagaccaaggatcgg
ctttgctttgtaatggaatacgtcaatggaggagagctgtttttccacttgtcaagagag
agggtgttttcagaggaccgcactcgtttttacggcgccgagattgtttctgctttagac
taccttcattctgccaagatcgtctaccgtgacctcaagctggaaaacctcatgttagac
aaagacggccacatcaagatcacagattttggcctgtgtaaagaggggattaccgacact
gcgaccatgaagaccttctgtggaacaccagagtaccttgctcctgaggttctggaggac
aacgactacgggcgagcggtggactggtggggtctgggcgtcgttacctatgagatgatg
tgcggccggcttccgttctacaaccaggaccacgagaagctgtttgagctcatcctgatg
gaggagatcaagtttccacgaaccctgtctgctgatgccaagtcactgctgtcaggcctg
ctgatcaaggaccccaacaaacggctgggcggcgggccggatgacgctaaggagattatg
aggcacagcttcttcggcacagtcgattggcaggacgtgtacgacaagaagctggtcccg
cccttccagccgcaggtctcctcagagacggacacgcgctactttgacgaggagttcaca
gcacagaccatcaccatcactccaccagaaaaatatgacgaggacgggatggacgcagcg
gacaacgagcgacggcctcatttcccacagttctcctactcagccagcgggcgggagtga

KEGG   Poecilia reticulata (guppy): 103474789
Entry
103474789         CDS       T05149                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04218  Cellular senescence
pret04261  Adrenergic signaling in cardiomyocytes
pret04370  VEGF signaling pathway
pret04371  Apelin signaling pathway
pret04510  Focal adhesion
pret04620  Toll-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103474789
   04012 ErbB signaling pathway
    103474789
   04370 VEGF signaling pathway
    103474789
   04371 Apelin signaling pathway
    103474789
   04068 FoxO signaling pathway
    103474789
   04150 mTOR signaling pathway
    103474789
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103474789
  09143 Cell growth and death
   04210 Apoptosis
    103474789
   04218 Cellular senescence
    103474789
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103474789
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103474789
   04625 C-type lectin receptor signaling pathway
    103474789
  09152 Endocrine system
   04910 Insulin signaling pathway
    103474789
   04920 Adipocytokine signaling pathway
    103474789
   04914 Progesterone-mediated oocyte maturation
    103474789
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103474789
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103474789
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103474789
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103474789
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103474789
Protein kinases [BR:pret01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103474789
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 103474789
NCBI-ProteinID: XP_008424234
UniProt: A0A3P9NFE9
LinkDB
Position
LG13
AA seq 482 aa
MDEVTVVKEGWLHKRGEYIKTWRPRYFILKSDGSFIGYKDKPEVSSDLSLPPLNNFSVAE
CQLMKTERPKPNTFVIRCLQWTTVIERTFHVETNSEREEWMQVIQTVANSLKSQQQDEEP
MEIKFGSPSDSTGAEEMEIAMCKSRSKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRIFTEDRARFYGAEIVSALEYLHSRNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKTLAPEGKALLAGLLKKDPKQRLGGGPDDAKDVMTHKFFALINWQDVIE
KKLIPPFKPQVTSETDTRYFDDEFTAQSITITPPDKYDSLDVEDSDQRTHFPQFSYSASI
RE
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggatgaagtcactgttgttaaagaaggatggctccacaagagaggtgaatacatcaaa
acatggcgacctcgctacttcatcctgaagagcgatggatcctttatcggatacaaagac
aagccggaggtgtccagtgacctcagcctgccgccgctcaacaacttctccgtcgcagag
tgccagctgatgaagacggagcgccccaagcccaacacatttgtaattcgatgtctgcag
tggaccactgttatagagcggactttccatgtggagaccaacagcgagagggaggaatgg
atgcaggtgatccagacagtagcaaacagcttgaagagtcagcagcaggacgaggagccc
atggagataaaatttggctcgcccagtgacagcaccggcgcagaggagatggagattgct
atgtgcaaatcccgttcaaaagtgaccatgagtgactttgactacctgaagctgctgggc
aaagggacgtttggaaaagtgatcttggttaaggagaaagctacggggatgtactacgcc
atgaaaatccttcgcaaagaagtcatcattgctaaagatgaggtggctcacacagttaca
gagagcagagttctccaaaacacacggcatccttttctaacgacactaaaatatgcattt
caaacacacgaccggctatgctttgtgatggagtatgcaaatggaggagaactcttcttt
cacttatcccgggacaggatattcacagaagatagagcacggttctatggtgcagaaata
gtatcagcactggagtatctacactcacgcaatgtcgtttacagggacttaaagctggag
aacctgatgttggacaaagacggccacataaagataacagactttgggctgtgcaaggag
ggaattacagacggtgccaccatgaaaaccttttgtggaactccagagtacctggcgcca
gaggtactggaggacaacgactatggccgcgccgtggactggtggggactgggagtggtg
atgtatgagatgatgtgtggtcggttaccgttctacaaccaggaccacgagcgtctgttt
gagctcatcctcatggaggagatccgcttcccgaagaccctggcgccggagggcaaggcc
ctgctggcaggcctgctgaaaaaagatcccaaacaaaggcttggaggtggaccagacgat
gccaaagatgtaatgacccacaagttctttgccttgataaactggcaggacgtgattgaa
aaaaaacttatcccacccttcaagccccaagtaacatcagagacagacacccgttacttc
gatgatgagttcacagcacaatctattacaataactcctccagacaagtatgacagctta
gatgttgaggattcagatcagcgtacacacttccctcagttctcctactctgccagcata
cgggaatga

KEGG   Poecilia reticulata (guppy): 103476681
Entry
103476681         CDS       T05149                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04218  Cellular senescence
pret04261  Adrenergic signaling in cardiomyocytes
pret04370  VEGF signaling pathway
pret04371  Apelin signaling pathway
pret04510  Focal adhesion
pret04620  Toll-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04914  Progesterone-mediated oocyte maturation
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103476681
   04012 ErbB signaling pathway
    103476681
   04370 VEGF signaling pathway
    103476681
   04371 Apelin signaling pathway
    103476681
   04068 FoxO signaling pathway
    103476681
   04150 mTOR signaling pathway
    103476681
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103476681
  09143 Cell growth and death
   04210 Apoptosis
    103476681
   04218 Cellular senescence
    103476681
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103476681
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103476681
   04625 C-type lectin receptor signaling pathway
    103476681
  09152 Endocrine system
   04910 Insulin signaling pathway
    103476681
   04920 Adipocytokine signaling pathway
    103476681
   04914 Progesterone-mediated oocyte maturation
    103476681
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103476681
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103476681
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103476681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103476681
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103476681
Protein kinases [BR:pret01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103476681
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 103476681
NCBI-ProteinID: XP_008427392
UniProt: A0A3P9NSM7
LinkDB
Position
LG15
AA seq 479 aa
MSDVTIVREGWLQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERIQCS
PTSNIDNMVEEEMDISTTHHKRKTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEERTRFYGAEIVSALNYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPEDAKEIMRHSFFSGIDWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKFDEDGMDCLDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgttagagagggatggctccagaaaaggggtgaatacataaag
aactggcgaccacgttacttcctgctgaagacagacggctccttcattggctacaaagag
aaacctcaggatgcagacctcccttatcctctaaataacttttcagtagcaaaatgccag
ctgatgaagacagagaggccgaagccaaacaccttcatcatacgctgccttcagtggacc
actgtcattgaaaggaccttccatgtggattcgcctgatgaacgagatgagtggacagag
gccatccagatggtggcagacaagctgcaaagacaagaagaggagaggatccagtgcagc
cccacctccaatattgacaacatggtggaggaggaaatggacatctccactacacaccac
aaacgcaagacgatgagtgactttgactacttgaagctgctggggaagggaacgtttggt
aaagtcatccttgtccgggaaaaggccagcgggaagtattacgccatgaaaatccttaaa
aaagaagtcatcatagccaaggatgaagttgctcacacactcacagagagcagagtactg
aaaaacaccaggcacccttttctcacttcgctgaagtattcattccagactaaagaccgt
ctctgttttgtcatggagtacgtgaatggaggggagctgtttttccatttgtccagagag
cgagtgttctcggaggagcgcacgcgcttctacggtgccgagattgtctcagctctcaac
tacctgcattcagccaagattgtgtaccgggacctcaagttggaaaacctgatgctggat
aaagatggtcatataaaaatcacagattttggactctgcaaagagggcatcactgatgct
gctacaatgaagaccttctgtggaacgccggagtacctcgctccagaggtgctggaggac
aacgactacggccgtgccgtggactggtgggggctgggtgtggtgacgtacgagatgatg
tgcggccggctgccgttctacaaccaggaccacgagaagctgttcgagctcatcctcatg
gaggacatcaagttcccgcgcacgctgtcggcggacgccaagtcgctgctgtctggcctg
ctcatcaaagacccaaacaaaaggctcgggggcggaccagaagacgctaaggaaataatg
aggcacagtttcttctctggcatcgactggcaggatgtctacgacaaaaagctcgtccct
cccttcaagcctcaggtgacgtcggagacggacaccaggtacttcgacgaggagttcacg
gctcagaccatcacaatcactccaccagagaaattcgatgaggatggaatggactgtctg
gacaacgagaggcgaccgcacttcccgcagttctcgtactcggccagcgggcgagaatga

DBGET integrated database retrieval system