KEGG   Poecilia reticulata (guppy): 103458616Help
Entry
103458616         CDS       T05149                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00250  Alanine, aspartate and glutamate metabolism
pret00410  beta-Alanine metabolism
pret00430  Taurine and hypotaurine metabolism
pret00650  Butanoate metabolism
pret01100  Metabolic pathways
Module
pret_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103458616 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103458616 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103458616 (gad1)
   00430 Taurine and hypotaurine metabolism
    103458616 (gad1)
Enzymes [BR:pret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103458616 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 103458616
NCBI-ProteinID: XP_008397786
LinkDB All DBs
Position
LG2
AA seq 595 aa AA seqDB search
MAASAPSSSSSSSGAGADPNSTNLRPPGSSYDAWCGVAHGCTRKLGMKICGFLQKNNSLE
ERSRIVSSLKERTAQNLMACDNAGGDARFRRTETDFSNLYARDLLPSKNGEETTLQFLLE
VVEILTSYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYG
VRTGHPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGW
PNGEGDGIFSPGGAISNMYSVMIARYKSFPEVKTKGMAAAPRLVLFTSEHSHYSIKKASA
ALGFGTENLILLKTDERGRVIPADLEAKVMEVMQKGYVPMFVNATAGTTVYGAFDPINEI
ADICEKYNIWLHVDGAWGGGLLMSRRHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVR
ERGLLQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQH
IDKCLDLSAYLYDKIKNXEGFEMVFKSEPQHTNVCFWYIPPSLRGMPDGKEKRERLHKVA
PKIKALMMESGTTMVSYQPQGDKVNFFRMVISNPAATRSDIDFLVEEIERLGHEL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctgcaccctcctcctcctcctcttcctccggcgccggagcggatcccaac
tcgacaaatttacggccgccgggctcaagttatgatgcgtggtgtggagtagctcatgga
tgtacaagaaaattaggcatgaagatctgtggatttctgcagaagaacaacagtctggag
gagaggagcaggattgtgagctccctgaaggagcgcacggcccagaacctcatggcctgc
gataacgccggaggagacgcgcgtttcaggcggacagagacagacttctccaacctgtac
gccagagatctgttaccatcaaagaatggagaggagacgaccttgcagttcctgctggag
gtcgtggaaatcctcaccagctacgtcaggaaaacctttgacagatccaccaaggtcctg
gacttccaccatcctcaccagctgctggagggtatggagggcttcaacctggagctctcc
gaccagcccgagtctctggagcagatcctggtggactgcagggacactctgaaatatgga
gtgagaacaggccaccccaggttctttaaccagctgtccactggattagacatcgtgggc
ttggcgggagagtggctcacctccacagccaacactaatatgttcacttatgagatcgcc
ccggtttttgtgctgatggagcagctgacgctcaagaagatgagagagatagttggctgg
ccaaacggagagggagacggaatattttctccaggtggcgctatctccaacatgtacagc
gtgatgattgccagatacaagtccttccctgaagtcaagaccaaaggcatggcagctgca
ccccgactggtgctcttcacttctgagcatagccactattccatcaagaaagcaagtgca
gctctgggctttggaacagagaaccttatcctattaaagacagatgagagagggagagtc
attcctgctgatctggaggcaaaagtaatggaggtcatgcaaaaggggtacgttccaatg
tttgtgaacgccactgccggcaccactgtctacggagcctttgaccccatcaatgagatc
gcagacatctgtgagaagtacaacatatggctccatgtagatggtgcatggggaggaggc
ttgctgatgtccaggagacacagacacaaactgaatggagtagaaagggcgaactcagtc
acctggaaccctcacaagatgatgggagtgccactgcagtgctctgccattctggtcaga
gagaggggacttttacaaggctgcaactctatgtgcgcgggctacctgttccagccagac
aagcagtacgacgtcacctacgacacgggggataaggccattcagtgcggacgccatgtt
gatatctttaagttctggctcatgtggaaggcaaagggaacagtaggatttgagcagcat
atagacaagtgcttggatctgtcggcgtacctctacgacaaaataaaaaacaragaggga
tttgagatggtgttcaagtcagagccgcagcacactaatgtctgcttctggtacattcct
ccgagccttcgtggcatgcctgatgggaaagagaagcgcgagagactgcacaaggtggct
cccaagatcaaggccctgatgatggagtcgggtaccaccatggtgagttaccaaccacag
ggagacaaagtcaacttctttcgcatggtcatctccaaccctgcagccaccaggtcagac
atcgacttcctggttgaggagatcgagcgactgggccatgaactgtga

DBGET integrated database retrieval system