KEGG   Poecilia reticulata (guppy): 103459028Help
Entry
103459028         CDS       T05149                                 

Gene name
gstz1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00350  Tyrosine metabolism
pret01100  Metabolic pathways
Module
pret_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103459028 (gstz1)
Enzymes [BR:pret01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     103459028 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 103459028
NCBI-ProteinID: XP_008398448
LinkDB All DBs
Position
LG22
AA seq 220 aa AA seqDB search
MRLTLVCLMKPVLHGYFRSSCSWRVRIAFALKGIEYDQVAVNLIKDGGQQLTEQYKTLNP
MQQVPAVEIDDITLSQSLAVIQYIDETRPGPRLLPADPKARAQVRMISDLIASGIQPLQN
LSVLQKIGVEKLPWAQHFINRGFQALEPILKQTAGKYCVGDEISMADICLIPQVYNAERF
KVDVGQYPTIKRLNETLAEIEAFKLSHPSRQPDTPADLQA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgaccttagtttgcctaatgaagcctgttcttcatggatacttcaggagctcc
tgctcatggagggtccggatcgcttttgctcttaagggcattgaatatgaccaggttgca
gtcaatctaatcaaagatggaggtcagcagcttacagagcagtacaaaacactgaacccc
atgcagcaagttcctgcagtggaaattgatgacatcactctgtctcagtcgcttgcagtg
atccagtacattgacgagaccagaccaggacctcgtcttcttcctgcagacccgaaggca
cgtgcccaggttcgcatgattagtgacctcatcgcctctgggatacagcctcttcagaat
ttatctgtactccagaagatcggagtggaaaaattaccgtgggcacaacatttcatcaac
cgtggttttcaagctttagaaccaattctgaagcagactgcaggaaaatactgtgtaggc
gatgagatttccatggcagatatttgtttaatcccacaagtctacaatgccgagaggttt
aaagtggacgtaggccagtatccaaccatcaaaaggctgaatgagaccttggctgagatt
gaagctttcaaactgagccatccatctcgccaaccagacacacctgctgatcttcaagca
tga

DBGET integrated database retrieval system