KEGG   Poecilia reticulata (guppy): 103459218
Entry
103459218         CDS       T05149                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: leptin-B-like
  KO
K05424  leptin
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04060  Cytokine-cytokine receptor interaction
pret04080  Neuroactive ligand-receptor interaction
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103459218
   04060 Cytokine-cytokine receptor interaction
    103459218
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103459218
Cytokines and growth factors [BR:pret04052]
 Cytokines
  CSF and other factors
   103459218
SSDB
Motif
Pfam: Leptin BLOC1_2
Other DBs
NCBI-GeneID: 103459218
NCBI-ProteinID: XP_008398820
LinkDB
Position
LG23
AA seq 199 aa
MQDQTGFMTEADYLNEICKRDVLXSFIATGGQPEVEKQSSFFKMCVPLALLFVSLMAAPE
CSSLPTKTDSIRSNIHNIVNIAQITLVHIDKLNNKTPLQVEVSTPPMNGLTDISLYLGHL
DDELQSPFTNRLSQIQADVSSLDSRVRSLALMLDCPIQDKPSVEPRDLLFPDSQHYVTLA
KVQHYLENLPSNEEKLKVC
NT seq 600 nt   +upstreamnt  +downstreamnt
atgcaagaccagacaggattcatgacggaagctgactacttaaatgagatctgcaaaagg
gatgtgctannttcattcattgccactggaggacaaccagaagttgaaaaacaaagttca
tttttcaagatgtgcgtccctctggccctgttgttcgtctctctaatggcagctcctgag
tgctcaagtcttccaacaaagaccgactccatcagaagcaacatacacaacatagtaaac
attgctcagataactctggtccacatagacaaactaaacaataagacgcccctacaggta
gaggtctccactcctcccatgaacggattaactgatatcagcctctacctcgggcattta
gatgacgagctgcagagccccttcacgaatcggctgagtcagattcaagctgacgtttcc
agcctggactccagggtgcgctctctcgccttaatgttggactgccccatccaggacaaa
ccgagtgtggagcccagggaccttttgttccctgacagccagcactatgtgacgctggcg
aaggtgcagcactacctggagaacctcccttcaaatgaggagaaacttaaggtttgctga

DBGET integrated database retrieval system