KEGG   Poecilia reticulata (guppy): 103459268
Entry
103459268         CDS       T05149                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04020  Calcium signaling pathway
pret04260  Cardiac muscle contraction
pret04261  Adrenergic signaling in cardiomyocytes
pret04270  Vascular smooth muscle contraction
pret04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103459268
   04020 Calcium signaling pathway
    103459268
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103459268
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103459268
   04261 Adrenergic signaling in cardiomyocytes
    103459268
   04270 Vascular smooth muscle contraction
    103459268
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pret04040]
    103459268
Ion channels [BR:pret04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103459268
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 103459268
NCBI-ProteinID: XP_008398912
LinkDB
Position
LG23
AA seq 2342 aa
MVNESKNMYIPEDTLENHQGSDYSPPPLPRPPPVGLTNEHRGGGSHGDHSGGGGGVNRGV
GVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAASGGGAGLGSGGGGPISTASSTQRK
RQHYASKPKKQTTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVAL
AVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFI
IVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSI
IKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCRYSHSDTNAEEKPAPCAPDGAYG
RHCMQNGTKCQVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPW
VYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWIT
QAEDIDPENEEEGLDDDKPRNRKGRHFLSLRGAVKKNAAFLRKALSMPASENESVNTDNA
PGGDVEGETCCTRLAIRISKSKFSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTL
TIASEHHKQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDDTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG
PSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARL
ASPEKRQNNEKPPIEEKKSEKIELKSITSDGETNTATKINMDDCCGDENEEKNPYPVNDY
IGKVQRDEDEDEPEMPVGPRPRPLSDIQLKEKAIPMPEARAFFVFSHTNKFRVLCHKIVN
HNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAF
LHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHV
VQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCSDSSKQTQAECRGSYIMYKD
GDVGKPEKALRIWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNY
RVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARP
LRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLF
TGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALI
VVGSIVDIAITEVNPADSSSSSSSSSSSSSSSSSSSHPHVVRPMGLQNSEENARISITFF
RLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALR
DHTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNHPCEKGSTNENSTTHDDCGS
QFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAK
GRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTA
LRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR
KFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAISGDLNVEEEIDKGMKESVSA
ASEDDIFRVKRTGGLFGNHVNYYNQTDGRGSFPQSFTTQRPLHISQKGSPCEGESPSHEK
LMDSTTFTPSSYSSSGSNANINNANNTGMTGVTTQGVSRFPSPSISTVDGHTGQPLTPIL
LPRSAWCFPPKRMFYDTLMRSDSSDSRLPIIQRGEGSTEETYDESYGDDREYQDDEHSLS
SDMLVYHDETCKQLTPMEEAEEVEEQKGGGGWQSPRRVFLCPTTLTRRSSFHLECLRRQT
RPDVSQKTAVPLHLVHHQALAVAGLSPLLRRSHSPTLFSRLCSTPAANPTDQCSDASYQR
VPSLRLEGSNSHEKLNTSLPSVNCGPWYNDSNGNSPVDSPSPTPVPSQRPPRPVSLTVPL
LSGKDPSSLSHGSAGSLVEAVLISEGLGHFAQDPSFIEATKAELADACDMTIEEMEHAAS
NILNGNTATNPTSSTSSTSQHSPNGSLPCHNAAAATHRDRVADLSPGDAEAEAGGGRGYI
HGPSSIEERQELLARGGGREEEEEEANVREERPHRNSAVVAGARQKNSRLLEDEDLECVT
SL
NT seq 7029 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacatcccggaggacacccttgagaaccatcaaggc
tccgactactctccccctcccctccctcggcctcctccggttggcttgacgaacgagcac
agaggcggcggtagccatggcgaccacagcggcgggggaggaggggtcaaccgtggggtg
ggtgtggttggccttgcaccggagcacattcccaccccgggagcagccctgagctggcag
gcggccattgacgccgcgcggcaggcgaagatgatgggcaatgctgcgtcaggcggaggg
gcggggctcgggtcgggcgggggcggccccatttccacagccagctccacgcaaaggaag
agacaacactacgcttctaaacccaagaaacaaaccacaacgacagccacgaggccgccg
cgggccctgctttgtctcacactcaagaaccccatccgacgggcgtgcatcagcatcgtg
gagtggaaaccatttgagatcatcatcctgatgaccatctttgctaattgtgtggcctta
gccgtctacatccccttccccgaggatgactcgaatgccaccaactccaacctggagcgc
gtggagtacctgttccttatcatttttactgtggaggcgttcctcaaggtaatagcttac
ggcctgctcttccaccccaacgcctacctgaggaacggctggaatctgctcgacttcatc
attgtagtagtaggattattcagtgcgattttggagcaggccacaaagggagatggggcc
actccgattggagggaaggcggcaggcttcgatgtcaaggctctgcgggcattcagagta
ctaagaccgctcagactggtctctggagtacccagtttacaagtcgtgttgaactccata
atcaaagccatggttcctctgctccacatcgccctcctggtcctcttcgtcatcatcatc
tacgccatcatcggcctggagctcttcatgggcaagatgcacaagacctgcagatacagc
cattcagatacaaacgcagaggaaaaaccagcaccatgtgcacctgacggcgcttacggt
cggcactgcatgcagaacggaaccaagtgccaagtgggttgggaaggcccgaatgatgga
atcaccaactttgacaactttgcctttgccatgctgacagtgttccagtgcataaccatg
gaaggctggacggacgtgttgtactggatgcaggatgctatgggctatgagctgccatgg
gtctattttgtctctcttgtcatctttggctcatttttcgttctcaacctcgttctgggt
gtgttgagcggagagttttccaaggaaagagagaaggccaaggcacgtggtgacttccag
aaactacgagaaaaacagcaactggaggaggaccttaagggctatttagactggatcact
caggccgaagacatcgacccagagaacgaagaggagggcttggacgatgacaaacccaga
aaccgtaaaggtcgacattttctctctctgcgtggagccgtgaagaaaaacgcggctttc
cttcgtaaggcgttgagcatgccagccagtgaaaacgaatcagtcaacacagataacgct
cccgggggagatgtggagggagagacctgctgcaccagactggcaattaggatctccaaa
tccaagttcagtcgctactctcgcaggtggaacaggttgtgcaggcgaaagtgtcgagca
gcagtcaagtcccaggttttctactggctggtcatcttcctggtttttctcaacaccctg
accatcgcctctgaacatcacaagcagccgcagtggctaacagacgtgcaagatatagca
aataaagtattactagcgctcttcactggtgagatgctcctaaagatgtacagtcttggt
ctacaggcgtacttcgtgtcgctcttcaacaggttcgacagcttcgtcgtgtgcggagga
atactagagaccattctagttgaaacaaagatcatgtctcctcttggcatctcagtgttg
cgttgcgtgcgcctgttgagaatatttaaaataacaagatactggaactctctctccaac
ctcgtggcctcgcttctcaactcagttcgttccattgcctccctgctgctcctgctcttc
ctcttcattatcatcttctcgctcctgggcatgcagctcttcggggggaaattcaatttt
gacgacaccagacggagcacctttgacaactttccccagtctctgctcactgtgttccag
attctaacaggagaagactggaactccgttatgtatgatggcatcatggcgtatggaggc
ccgtcttttcccggcatgctggtctgcatctacttcatcatcctcttcatctgcggaaac
tacatcctactgaatgtcttcttggccatcgctgttgacaatctagcagatgccgagagt
ctgacgtcggctcagaaagaagaggaggaagcgaaggagaggaaaaaactggccaggctt
gccagtccagagaagcgtcagaataacgaaaagccaccgatagaggaaaagaagagtgag
aagattgagctgaagtccatcacttctgatggagaaaccaacactgcaaccaagatcaac
atggatgactgttgtggagatgaaaatgaagagaagaacccgtatcctgtgaatgattac
ataggtaaagtgcaaagagatgaggacgaggacgagccggagatgccggtgggcccgagg
ccgcggccgctctctgacattcagctaaaggagaaggccattcccatgcccgaggcccgc
gccttcttcgtcttcagccacaccaacaaattcagggttctgtgccacaagattgtcaac
cacaacatcttcaccaatctcatcctgttcttcatcctgctgagcagcatcagtctggcg
gcagaggatccggtcaagaacgactctttcagaaatcagatcctgggctatgcagatcac
gtcttcactggactcttcaccattgagatcattcttaagatgacagcctatggagccttc
ctccataaaggttcattctgtagaaattatttcaacattctggacttagtggtggtcagc
gtttctctcatctcttctggaatacagtccagtgcaattaatgttgtaaagatcctgaga
gtcctgcgagtgctgagaccgctgagagccatcaacagagccaaaggactaaagcatgtt
gtgcagtgcgtttttgtggccatcagaaccatcggcaacatcgtcatcgtcactacattg
ctccagtttatgtttgcctgtattggggtgcaactattcaagggcaagttcttctactgt
agtgacagctccaaacagactcaggcagagtgcagaggttcctacatcatgtataaggat
ggggatgtggggaaaccagaaaaagccctgagaatctgggaaaacagcgacttcaacttt
gatgatgtcctgcagggaatgatggctttgtttgccgtgtctacgtttgagggctggccc
gggttgctgtaccgagccatagactctcacgctgaagatgtcggaccaatctacaactac
cgcgtggtcatttctatcttcttcatcatctacatcattatcatcgcctttttcatgatg
aacatcttcgtcggtttcgtcatcgtcacatttcaggagcaaggagagcaggagtataag
aactgtgagctggacaagaaccagcgtcagtgtgtggaatacgccctgaaggctcgacct
ctgcgtcgctacatccccaagaacccttaccagtacaaggtgtggtatgtggtcaactct
acctacttcgagtacctgatgttcactctcatcctcctcaacaccatctgtctggccatg
cagcaccacggacagaccaaaaatttcaatgatgcaatgaacatcctcaacatgctcttc
acaggactgttcacagtagagatgatcctaaaattaatcgccttcaagcccagggggtac
tttagtgatccctggaatgtgtttgatttcctcatcgtaattggcagcataatagacgtc
attctcagtgagatcaaccattattttgttgatgcatggaacacatttgatgccttgata
gttgtgggtagcattgttgacatagcgatcactgaggttaacccagctgactcgtcctcg
tcctcctcctcctcctcttcgtcctcctcttcctcttcttcctcctctcacccccatgtg
gtaaggccaatgggacttcagaattctgaagagaacgccaggatctccatcaccttcttc
cggctgttccgcgtgatgaggctggtgaagctgctatctcgcggggaagggattcggacc
ctgctgtggaccttcatcaaatctttccaagctctgccttatgtagctctgctaatagtg
atgctcttcttcatatacgccgtcattggcatgcagatgtttggtaagatagcactgcgg
gaccacacgcaaatcaacaggaacaacaatttccagacgttccctcaggcagtgctgctg
ctcttcagatgtgcaactggtgaggcgtggcaagagatcatgctggcgtgttcgcccaat
cacccatgcgagaaagggtcaaccaatgaaaacagcacaacccatgatgattgtggcagc
cagtttgccatcatttactttgtcagcttctacatgctgtgtgcctttctgatcatcaac
ctttttgtggctgtaataatggacaactttgactatttgacacgtgactggtcaattttg
gggcctcatcatcttgatgagtttaagagaatctgggctgaatacgacccagaggccaag
gggaggataaaacaccttgacgtggtcaccttgctccggagaattcagcctcccctcggt
tttggaaagctctgtccacaccgggtggcgtgcaagcgcctggtgtcgatgaacatgcct
ctgaacagcgatggaacggttatgttcaatgccacactgtttgctttggtcagaactgca
ctcaggatcaagacagaaggtaatctggagcaggctaacgaggagctaagagcaattgtg
aaaaagatctggaagagaactagcatgaagctgttggatcaagtagtgccccctgctggt
gatgatgaagtaacagttggaaagttctacgccaccttcctcatccaagaatatttccgc
aagtttaagaagagaaaagaacaaggcctggtggccaaggtgcctcccaaaactgccctc
tctctgcaggcgggcctgcggacgcttcatgacatcggtccagagatcagaagggccatc
tctggagacttgaacgtggaggaggagatagataaaggcatgaaggaatccgtgtcagct
gcatctgaggacgatatcttcagggtaaagcgaacgggtggcttgttcggcaaccacgtc
aactactacaaccagaccgacggccgtgggtccttcccacagtccttcaccactcaacgt
cccttgcacataagtcagaaaggctctccgtgcgaaggggaaagcccgtcacacgagaag
ctgatggactcaaccacgttcaccccttcatcgtactcctcatcaggttcaaacgccaac
atcaacaacgccaacaacactggaatgaccggagtgacgacccagggcgtcagtcgattc
ccaagcccgtccataagcacggtggatgggcacacaggccagcccctcacacccatccta
ctacctagatcagcgtggtgtttccctccaaaaaggatgttttatgacaccctcatgcgc
tcggactcgagtgacagtcgtctgccaatcatccagagaggggaggggtcaacagaggag
acgtacgatgagagttatggtgacgacagggagtaccaggacgatgagcactcactttct
tctgacatgttggtgtatcatgacgaaacatgtaaacagctcactcctatggaggaagca
gaagaagtagaggagcaaaaaggaggaggagggtggcagtctccacgaagagtcttcctc
tgtccaactaccctgacacggagatcttccttccacctggagtgtctccggaggcagaca
aggccagatgtctcgcagaagactgctgtacctttacatcttgtacatcaccaggctctt
gcagtggcaggcttgagtccccttttgagaaggagtcactcacctaccctcttcagccga
ctgtgttccacgcctgcagctaaccccacagaccaatgcagtgatgcctcctaccagaga
gttccttctttaagactagagggctccaactctcatgaaaagctcaataccagcctgcct
tctgtaaattgtgggccctggtacaacgacagtaatgggaatagcccagtggacagtcct
agccctacgccggtgcccagtcaaaggccaccgcggccggtgtcactcactgtaccattg
ctttcggggaaggaccccagctcactgtctcatggcagtgcaggcagtctagtggaagcg
gttcttatatcagaaggtttgggtcattttgcccaggatccttcattcattgaggcaacc
aaagccgagttagctgatgcctgcgacatgaccattgaggagatggagcacgcagccagc
aacattctcaatggcaacaccgccacaaaccccacatcaagcacctcttccacctctcag
cacagccctaacggcagcctcccctgccacaatgcagcagctgcaacgcacagggaccga
gtcgccgacctgagtccaggcgacgcggaggcagaggctggaggcggtaggggctacatc
catggtccatcctctatagaggagcgacaggaactgctagctagagggggagggcgagaa
gaggaggaggaagaggctaatgtgagagaagagagaccccacagaaattcagctgtggtc
gcaggagcacggcagaagaacagcaggcttttggaggatgaggatttggagtgcgtgacg
agcttgtag

DBGET integrated database retrieval system