KEGG   Poecilia reticulata (guppy): 103459286
Entry
103459286         CDS       T05149                                 

Definition
(RefSeq) adiponectin receptor protein 2
  KO
K07297  adiponectin receptor
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103459286
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-GeneID: 103459286
NCBI-ProteinID: XP_008398972
LinkDB
Position
LG23
AA seq 368 aa
MSPREKNTRNTSGSSTSHLSTAECPSHHGSVHECHEEDDRGEERDQNEDERSSDEGFMAR
TPLLQAHHAMEKMEEFVHKMWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKS
IFRIHTETGNIWTHLLGCLFFLCLGLMYMFRPNMSFVAPLQEKVVIGMFFLGAILCLSFS
WLFHTVYCHSEGVSRIFSKLDYSGIAFLIMGSFVPWLYYSFYCSPQPCFIYLIIVCVLGL
AAITVSQCDFFATPQYRAVRAGVFVGLGLSGVVPTLHFVISEGLIKATTIGQMGWLFLMA
TLYITGACLYAARIPERFFPGKCDIWFHSHQLFHILVVAGAFVHFHGVSNLQEFRYTAGG
GCTEDGML
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgagtccacgggagaaaaacacacgcaacacctcaggctcttcaaccagtcacctcagc
accgcagagtgcccctcgcaccatggctctgtccacgagtgccatgaagaggacgacaga
ggagaggagagggatcagaacgaggatgagagaagcagcgacgaaggcttcatggcgaga
actccgttgctgcaagctcaccacgccatggaaaagatggaggagtttgtacataagatg
tgggagggtcggtggcgcgtcatccctcacgacgtgctcccggattggctgaaagacaac
gacttcctgctccacggccacagaccaccgatgccttcatttcgcgcctgcttcaagagc
atcttcagaatccacacagagacggggaacatttggacacacctgctaggctgcttgttc
ttcctctgcctgggtctcatgtacatgttcagacccaacatgtcttttgtggctccactg
caagagaaggtagtaattgggatgtttttcctcggagccatcctctgcctctccttctcc
tggctcttccacacagtctactgtcactcagagggcgtgtccagaatcttttccaaattg
gactacagtgggattgccttcctgatcatgggctccttcgtcccctggttgtactattct
ttctactgctcgcctcagccctgcttcatctacctgataattgtgtgtgtcctgggtctg
gctgccatcacagtttcacaatgtgactttttcgctactccgcagtacagagcagtcaga
gcaggagtgtttgtaggtttgggtctgagcggcgtggttcccacccttcactttgtcatc
agcgagggtctgatcaaagccaccaccatcggtcagatgggctggctgtttctcatggcg
acgctctacatcaccggcgcctgtctgtacgctgctcgcatcccagagaggttcttccct
ggcaagtgtgacatctggttccactcccaccagctgttccacatcctggtagtcgccggg
gctttcgtccattttcacggcgtctctaacttgcaggagtttcggtacactgcagggggc
ggctgcactgaggatggcatgctttaa

KEGG   Poecilia reticulata (guppy): 103465307
Entry
103465307         CDS       T05149                                 

Gene name
adipor1
Definition
(RefSeq) adiponectin receptor protein 1
  KO
K07297  adiponectin receptor
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103465307 (adipor1)
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-GeneID: 103465307
NCBI-ProteinID: XP_008408214
LinkDB
Position
LG5
AA seq 376 aa
MSVRNGSASDADCRISEDCSVPDVELMELGPLLEEGGGRQGPCKGIHPEGAAMLADEEEE
DDEVGEVLTLPLQAHHAMEKMEEFVHKVWEGRWRVIPFHVLPDWLKDNDYLLHGHRPPMP
SFRACFGSIFRIHTETGNIWTHLLGWILFVCLGTLTMLRPNMYFMAPLQEKVVFGMFFLG
AVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYL
TIVCVLGIAAIIVAQWDRFATPRHRPTRAGVFMGLGLSGIVPTMHFTIEEGFVKATTVGQ
MGWFYLMGAMYITGAGLYAARIPERFFPGKCDIWFHSHQIFHVLVVAAAFIHFYGVSNLQ
EFRYGLEGGCTDDSLL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtcagtccgaaacgggtctgccagtgatgcagactgccggatctctgaggactgcagc
gtcccagatgttgagctgatggagctcgggccgctgctggaggagggaggggggcggcag
gggccatgtaaaggcattcatccggagggagcagcgatgcttgctgatgaggaagaagag
gacgacgaggtgggcgaggttttgactttacctcttcaggctcatcatgccatggagaaa
atggaggagtttgtgcacaaggtgtgggaaggtcgctggagggtcattccttttcatgtc
ctgcctgactggctgaaggacaacgactacctgctgcacggacatcgacctccgatgccg
tcgttcagggcctgttttggaagtatcttcagaatccacactgagacgggaaacatctgg
actcatctgctagggtggatcttattcgtttgtctgggcactttaaccatgttgcgcccc
aacatgtattttatggcacctctgcaggagaaggttgtgtttgggatgttcttcctggga
gcagtcctctgcctcagcttctcctggctttttcatactgtctactgccactcggaaaaa
gtctctcgcacattctccaagctcgactactcgggcatcgccctcctgatcatgggctcc
ttcgtgccctggttgtactactccttctactgttcccctcagcctcgactaatctacctc
accatcgtttgtgttcttggcatcgctgccatcatagtggcccagtgggaccgattcgcc
acccctcgtcacaggccaacaagagcaggcgtgttcatgggtcttggacttagtggcatt
gtccccaccatgcacttcaccatcgaggaaggattcgtaaaggccaccacagtcggacag
atgggttggttttatctgatgggcgccatgtacatcaccggtgccggtctgtatgcggcc
agaatccctgaacgttttttccccgggaagtgtgacatctggtttcattctcatcagatt
ttccatgtcctggtcgttgcagcagcgtttattcatttctacggcgtctccaacctgcag
gagtttcgctacggcctcgaaggaggatgcacagatgactctctactctga

DBGET integrated database retrieval system