KEGG   Poecilia reticulata (guppy): 103459298
Entry
103459298         CDS       T05149                                 

Definition
(RefSeq) platelet glycoprotein 4-like
  KO
K06259  CD36 antigen
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03320  PPAR signaling pathway
pret04145  Phagosome
pret04512  ECM-receptor interaction
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    103459298
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103459298
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103459298
   03320 PPAR signaling pathway
    103459298
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103459298
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103459298
   04090 CD molecules [BR:pret04090]
    103459298
Membrane trafficking [BR:pret04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    103459298
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103459298
CD molecules [BR:pret04090]
 Proteins
  103459298
SSDB
Motif
Pfam: CD36 PorA
Other DBs
NCBI-GeneID: 103459298
NCBI-ProteinID: XP_017158178
LinkDB
Position
LG23
AA seq 375 aa
MVPEPNSHHQQEKSTQHRLNVGKFIKQEVNFMDLTKLRPETPLKSPSFQGAYSAIPTELH
SIVETLIKTTNSSLFQRRTVKELLWGYTDPILRGDVGFFLDYNNTYDGPFDVFTGKDDIA
NVGKIDKWKESKSLSFWNDEYCDMLNGTDASSFPPFVNKKDPLFFFSSDICRSVSASYER
TMNLKGIDVYRFSLHALTLASPEVNPDNKCFCSNMKTTKNCTLAGVLDISACQQGRPIYI
SLPHFLHGSPSLRTDVLGLNPHEEHHKTFLDVEPTSGFTLNFAKRIQVNMMYGPSKVITV
LKKVKDYTLFPLVWLNETATLDDETAEMFKKELISRIQMLEIIQQVLLGVGIGVFLLCLL
GFFIVRRSHNKKELA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggtaccagaaccaaacagtcaccaccagcaagagaaatcaacccagcaccgcctgaat
gtgggcaagttcataaagcaggaggtcaatttcatggaccttaccaagctccgcccagaa
acgcccctcaaaagtcccagttttcagggagcttattcagcgattccaacagagttgcat
tccatcgtggagacactgataaagaccaccaactcttccttatttcagcgccgcacagtc
aaagagctgctttggggatacacagatcccatactaagaggagatgtgggcttcttctta
gattacaataacacatacgatggccctttcgatgtcttcactgggaaagatgacatcgca
aacgtgggaaagatcgacaagtggaaagaaagcaagagcttaagtttctggaatgatgaa
tactgtgatatgcttaatgggacagatgcttcctccttccctccctttgtgaacaagaag
gatccgctctttttcttctcctcagacatctgcaggtctgtgtcagccagctatgagagg
actatgaatctgaaaggaatcgatgtgtaccgattctcacttcacgcattgactctggcc
tcccctgaggtcaatccagacaacaaatgcttctgctcaaacatgaagaccaccaaaaat
tgcacactggccggcgtgctggatatcagtgcctgtcagcaagggaggcctatttatatc
tcactgccccacttcctgcatggcagtccatcactgcggaccgatgtgcttggcttaaac
ccccatgaagagcatcacaaaacctttctggatgttgaacctacctctgggtttactctg
aactttgccaagagaattcaagtgaacatgatgtacggaccatcaaaagtcatcacggtg
ctcaagaaagtaaaggactacaccctgttccctcttgtttggctaaacgagacagcgacg
ctggatgatgaaacggcagagatgttcaagaaggagctcatttctcgtatccagatgctg
gagatcatacagcaggtgctcctgggtgtcggtattggcgtcttcctcctgtgtcttctt
ggtttctttattgtgcggaggagccataacaaaaaggagcttgcgtag

DBGET integrated database retrieval system