KEGG   Poecilia reticulata (guppy): 103459420
Entry
103459420         CDS       T05149                                 

Definition
(RefSeq) uncharacterized protein LOC103459420 isoform X1
  KO
K05461  KIT ligand
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103459420
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103459420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pret04052]
    103459420
Cytokines and growth factors [BR:pret04052]
 Growth factors
  Growth factors (RTK binding)
   103459420
SSDB
Motif
Pfam: SCF Tweety Pox_EPC_I2-L1 DUF2771
Other DBs
NCBI-GeneID: 103459420
NCBI-ProteinID: XP_008399167
UniProt: A0A3P9P6M4
LinkDB
Position
LG23
AA seq 253 aa
MRKKIISTTCVLLGLFSSLHLCSGKFGTPITDDVSKLSVLKQNIPSDYEIPVSYVPKEVA
GTCWVVLNIYPLERSLEKLASMFGAMSSNRDDINVFITMLKSLRLTFDHEELETAMQVFQ
CHYRERSLLSGLYFDYIQDLLHAATQGTSSFSCKPQPCLNHQQTAEGQEKSRKYRWLKSS
SVLLVLIPFTACIVLIVWQVKSGRNLIACNTSNGQTASPDMIPTVSVSIPLQTLTHADDS
QPTGEAISEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcatcagcacaacttgtgtcctcttgggtctgttttcaagtttgcat
ctctgctctgggaaatttggaacgccaataactgatgatgtgagcaagctgtctgtattg
aagcagaatatcccctccgattatgagattcctgtcagttacgttcccaaagaggtggcc
ggcacgtgctgggtggttttaaacatttatcctttggagcgaagtcttgaaaagctggcc
agcatgtttggtgccatgtcgtcgaacagagacgacatcaacgtcttcatcacgatgctg
aagagtttacgcctcacctttgaccacgaagagctggaaacagcgatgcaggtcttccag
tgtcactatcgagaaaggagcttgctctccggactttactttgactacatccaagacctc
ttgcatgcagccactcaaggaacatcaagtttctcttgcaagccacagccatgccttaat
catcagcaaacagcagaaggtcaggagaagagtcgaaaatacagatggttaaagagcagc
tctgtgcttttagtgctaatccccttcacagcctgtattgtgctgatagtctggcaggtt
aagtctgggaggaacttaatagcgtgcaacacttcaaacggccaaaccgcatctcctgac
atgatcccaactgtgtctgtctccatcccacttcaaacgctcacccacgccgatgacagc
cagccaacgggggaggcaatctctgaacatgagagtggatga

DBGET integrated database retrieval system