KEGG   Poecilia reticulata (guppy): 103459499
Entry
103459499         CDS       T05149                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103459499
   04068 FoxO signaling pathway
    103459499
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103459499
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103459499
NCBI-ProteinID: XP_008399331
LinkDB
Position
LG23
AA seq 174 aa
MCNNMSDVRLSNASPTVERVDARPLDNARSVRRVLFGTPDPEETRKQAEALQRQSVEAFR
DRYNFDPVEDRPLSPGLYDWQEDEDAPEFYRRPPRWSQPPRGEAGEGSRETRRERRSAHT
NGSRKRSSKSAGHCSDDCTSNGKKSHSDKDDDEEQALGAGSQAEQQQEEEEVPC
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcagacgttcgcctctctaacgcgagccccacggtggagcgggtg
gacgcgcggccgctggacaacgccaggtcggtccgcagggtgctgttcggcacacctgat
ccggaggagacgcggaagcaagcggaggctctgcagcggcagtccgtggaggcttttagg
gacaggtacaacttcgacccggtggaagacaggccgctctctccggggctttacgactgg
caggaggacgaagacgcgccggagttttaccgcaggccaccccggtggagccagccgccc
cggggagaggcaggcgaaggcagccgggagacgaggagggagaggcggtcggctcacact
aacggttcgcggaaacgatcttcaaaatctgcaggtcattgctctgacgattgcacgagt
aacggcaaaaagtcgcattccgacaaagacgacgatgaagagcaggcgctcggtgcagga
agccaggcagagcagcagcaggaggaggaggaggtcccatgctga

DBGET integrated database retrieval system