KEGG   Poecilia reticulata (guppy): 103459501
Entry
103459501         CDS       T05149                                 

Gene name
ppara
Definition
(RefSeq) peroxisome proliferator-activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103459501 (ppara)
   03320 PPAR signaling pathway
    103459501 (ppara)
Transcription factors [BR:pret03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    103459501 (ppara)
Nuclear receptors [BR:pret03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   103459501 (ppara)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 103459501
NCBI-ProteinID: XP_008399333
LinkDB
Position
LG23
AA seq 491 aa
MGNPYKFGSPIFNMAAELYSPPSPLGESLLDSTLCGDLIENLPDFSQSIEDDSLGFDFPE
YQTIGSGPSSSIPLDTLTPASSPLPGECGASLCPDENISPLNLECRVCTDKASGFHYGVH
ACEGCKGFFRRTIRLKLEYDKCERSCKILKKNRNKCQYCRFQKCVSVGMSHNAIRFGRMP
QAEKLKLKEESKVVETEEEDPVKADHKILVRILTSVAFPVSVSIKVKICGILDGLFLLFK
PFIIHDMETFQLAEKTLAAHMVRTESAEPDLHLQTGQIIPALVCEELQQREAEARLFYCC
QSTSVETVTELTEFAKAVPGFQSLDLNDQVTLLKYAVYEALFTLLASCMNKDGLLVARGG
GFITREFLKGLRRPFSDMMEPKFQFATRFNSLGLDDSDLALFVAAIICCGDRPGLVDVPL
VEQLQESIIQALRLHLLANHPDDAFLFPRLLQKLADLRELVTEHAQLVQDIKTTEDTSLH
PLLQEIYRDMY
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgggtaatccctataagtttggatccccgatcttcaacatggccgccgaactctacagc
cccccatcgcctcttggggaatccctcctggacagtacgctgtgtggagacctgatagag
aatcttcctgacttttcccagtcaatagaagacgactctctgggatttgattttccagag
taccaaaccattggttctgggcccagcagctccatcccattggatactctgactccggcc
tccagtcctttgcctggggagtgcggcgcatcgctttgtccagacgagaatatcagcccc
cttaacctcgagtgcagggtgtgcacagacaaagcttcaggctttcactatggagtgcat
gcatgtgagggctgcaagggtttctttcggaggaccatcagactgaagctggaatacgat
aagtgtgaacgcagctgtaagatcctgaagaagaatcgaaacaaatgccagtactgcagg
ttccaaaagtgtgtgtctgtggggatgtcccacaacgccatccggtttggtcgcatgccc
caagcagagaagctgaagctcaaggaggaaagcaaggttgttgaaacagaagaagaagat
ccggtcaaggccgaccacaagatcctggtcaggatcttgaccagcgtggctttcccagtc
agcgttagtataaaagtaaaaatctgtggaatactggatggactatttctgctttttaaa
ccttttatcatccatgacatggagacgtttcagcttgccgagaagaccctggcggcccac
atggtaaggactgaatctgcggagcccgacctccatcttcaaaccggacagataatccca
gcgctggtttgtgaggagctccagcaacgggaggcagaggccaggctcttctactgctgc
cagagtacctcagtggagacggtcacagagctaacagagttcgctaaagctgtgcctggc
tttcagagcttggatttgaatgatcaggtgactctcttgaaatatgcggtttatgaagcc
cttttcacccttctggcctcatgtatgaacaaagatggcctcctcgtggcacgtggtgga
ggcttcatcacccgggaattccttaaaggtctccggcggcctttcagcgacatgatggag
cccaaattccagtttgctactcgtttcaactctctaggtctggatgacagtgacctggcc
ctctttgtggcagctatcatctgctgtggagaccgtccaggactggtggatgtaccgctg
gtggagcagctgcaggaaagcatcatccaggccctgcggctccacctgctggccaatcat
ccagatgacgctttcctcttccccagactgctgcagaagctggctgacctcagggaactg
gtaacagagcacgcacagctggttcaggatatcaagacaacagaggacacttcactgcac
ccgctcctgcaggaaatctacagagacatgtattga

KEGG   Poecilia reticulata (guppy): 103465912
Entry
103465912         CDS       T05149                                 

Definition
(RefSeq) peroxisome proliferator-activated receptor alpha-like
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103465912
   03320 PPAR signaling pathway
    103465912
Transcription factors [BR:pret03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    103465912
Nuclear receptors [BR:pret03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   103465912
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 103465912
NCBI-ProteinID: XP_008409351
LinkDB
Position
LG6
AA seq 493 aa
MPFLCGRLFPVSCVTAPPARTTITMVDIESLYQPPSPLEDSVLDGPLCGDDDFMGSMEAL
QDIPTSLDEDALSSLDVTEYQSSHNGSEGSSILDALTPASSPSSVVCGMAPTQEELLSPS
SSLNLECRVCSDRASGYHYGVHACEGCKGFFRRTIRLKLEYDRCERRCKIQKKNRNKCQY
CRFQKCLAVGMSHNAIRFGRMPQSEKLKLKAEMVTGEREVVNPQLADQKTLARQIYEAYL
KNFNMNKAKARTILTGKTSNPPFVVHDMETLQLAEQTLVAKMVGSAGALKDREAEVRIFH
CCQCTSVETVTELTEFAKSVPGFSSLDLNDQVTLLKYGVYEALFAMLASSMNKDGLLVAY
GSGFITREFLKSLRRPFSDMMEPKFQFAMKFNALELDDSDLALFVAAIICCGDRPGLVNV
SHIEVMQESIVRVLQLHLLANHPDDTFLFPKLLQKLADLRQLVTEHAQLVQEIKKTEDTS
LHPLLQEIYRDMY
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgcccttcctctgtggcaggctttttccagtctcatgtgtgacggcaccaccagcacgc
accaccatcacaatggtcgacatagagagcctctaccagcccccgtctccgctggaggac
tcggtgctggatggccccctgtgtggtgatgacgatttcatgggcagcatggaggcgctt
caggacatccccacatcccttgacgaggacgcccttagctccctcgacgtcacggaatac
cagtcctcccacaacgggtctgaaggttccagtatcctagacgccttgacgccggcgtcc
agcccgtcctccgttgtttgcgggatggctcccacccaggaggagctcttatctccctcc
tcttcgctcaatctggagtgccgcgtgtgttctgaccgggcctcgggttaccactacggc
gttcacgcctgcgagggctgcaagggtttctttcggcggaccatccgtctgaagctggag
tacgacaggtgtgaacgccgctgcaagatccaaaaaaagaaccgcaacaagtgccaatac
tgccgcttccagaagtgcctggccgtgggcatgtcccacaacgccatccggttcggcagg
atgccccagtcggagaagctgaagctcaaggcagagatggtgacgggggagagggaggtg
gtgaacccccagctggctgaccagaagacgctggccaggcagatatacgaggcctacctg
aagaacttcaacatgaacaaggccaaggctcggaccatactcaccggaaagaccagcaac
cctccgttcgtggtccacgacatggagacgctgcagctggcggagcaaacgctggtggcc
aagatggtcggctcggcgggggccctcaaggacagagaggccgaggttcggattttccac
tgctgccagtgcacatcggtggaaaccgtcacggagctcactgagttcgcgaagtccgtg
ccgggcttctcgagcctggacctgaacgaccaggtgacgctcctgaagtacggcgtgtac
gaagcgctctttgccatgctcgcctccagcatgaacaaagacggcctcctcgtggcgtac
ggctcgggcttcatcacccgggagttcctcaagagcctgcggcggccgttcagcgacatg
atggagcccaagttccagttcgccatgaagttcaacgcgctggagctggacgacagtgac
ctggcgctgtttgtcgctgccatcatctgctgcggagaccgaccgggcctggtgaacgtg
tcgcacatcgaggtgatgcaggagagcatcgtccgcgtcctccagctccacctgctggcc
aaccaccccgacgacaccttcctgttccccaaactgctgcagaaactggccgacctccgg
cagctggtcacggagcacgcgcagctggtgcaggagatcaaaaagacagaggacacgtcc
ctgcacccgctcctacaggagatctacagagacatgtactga

DBGET integrated database retrieval system