KEGG   Poecilia reticulata (guppy): 103459579Help
Entry
103459579         CDS       T05149                                 

Gene name
gys2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
pret04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103459579 (gys2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103459579 (gys2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pret01003]
    103459579 (gys2)
Enzymes [BR:pret01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103459579 (gys2)
Glycosyltransferases [BR:pret01003]
 Polysaccharide
  Storage polysaccharide
   103459579 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 103459579
NCBI-ProteinID: XP_008399466
LinkDB All DBs
Position
LG23
AA seq 704 aa AA seqDB search
MPLSRSLSITSLSGLFPAWEDDELPMEDLMLFEVAWEVTNKVGGIYTVIQSKAKVTVDEW
GENYYMMGPYFEHNFKTQVEACVPPNPVIQKAMDALINNGCQVHFGRWLIEGSPYVILFD
IGSAAWNLDRWKGDLWETCHIGLPYHDREANDALILGSLVAWFFKELTDHLGDTPNVISH
FHEWQAGPGLILSRSRNIPMATVFTTHATLLGRYLCAGNVDFYNNLDKFNIDKEAGERQI
YHRYCMERAAVHCAHVFTTVSQITAVEAKHMLHRKPDVVTPNGLNVKKFSAMHEFQNLHS
TNKTRIQEFVRGHFYGHLDFNLDRTLFFFIAGRYEFSNKGADIFLESLSRLNYLLRVHRN
DLTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAHTVKEKFGKKLYESLLTGNIPDMNT
ILDRDDLTIMKRAIYATQRHSLPPVTTHNMLDDSEDPILFNVRRIGLFNSRNDRVKIIFH
PEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFM
EEHVSDPAAYGIYIVDRRFRSAEESCNQLTQFMLSFCQQSRRQRIIQRNRTERLSDLLDW
RYLGRFYTHARHLALSRSFPDKYKMDNKGPLKTEGFRYPRPASVPPSPSASLHSTPHHSD
EDDDDDEPYNEEEEAERDRLNIKAPFMLGSVPEGKKKQPGESGN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccattgtcacgttccctgtccattacatccctcagtgggctgtttccagcctgggag
gacgatgagctgcccatggaagacctgatgctttttgaagtggcatgggaggtcaccaac
aaagttggaggaatttacactgtcatccagtctaaagctaaggtcacagtggacgaatgg
ggagagaactattacatgatgggaccgtactttgaacacaacttcaagacacaagtggaa
gcctgtgtaccacccaacccagtgatccagaaggcaatggatgctcttatcaacaatgga
tgtcaggttcattttggtcgctggctgattgagggcagcccttatgttatcctgtttgac
atcggctcagcagcctggaacctggaccgatggaagggggacctgtgggagacctgccac
atcggtctgccgtatcacgatcgggaggctaatgacgctctcattctgggctccttggtt
gcctggttctttaaagagctaacagatcaccttggagacacacccaatgtcatcagtcac
ttccatgaatggcaggcagggcctgggcttattctctctcgctcccgaaacattcctatg
gcaacagtttttactacccatgccactttgctcggaagatatctttgtgctgggaatgtt
gacttttacaacaacttggataagttcaatattgacaaggaggcaggagagaggcagatc
taccatcggtactgcatggagcgagcagcggtgcactgtgctcatgtcttcaccacagtg
tcccagatcacagcagtggaggccaaacacatgctgcacaggaagccagatgtggtgacc
ccaaatgggctgaatgtgaaaaaattctcagccatgcatgagtttcagaacttgcactcc
actaacaagacccgcatccaggagtttgtcagaggacacttttatgggcatcttgacttc
aacttggatagaaccctgttctttttcattgctgggagatatgaattctccaacaaggga
gctgacatttttcttgaatcgctgtctagactcaactacttgctgcgggtccacagaaat
gacctgactgtggtggttttcttcataatgccagccaaaaccaacaacttcaatgtggag
tctctgaagggtcaggccgtgcgcaaacagctctgggacacagctcacactgtgaaggag
aagtttggtaaaaagctttatgaatctttgctgacaggaaacatcccagacatgaacacc
attctggacagagatgacttgacgattatgaagagagctatttatgctacacagagacac
agtcttcctccagtgaccactcacaatatgttggacgactctgaagatccaatactgttc
aacgtcagacgcattggtctcttcaattctagaaacgaccgcgtcaagatcatcttccac
cctgagttcttgtcctccaccagtcctctgctgcccatggattatgaggactttgtccga
ggctgtaaccttggagttttcccgtcctactatgagccatggggatacacaccaggtgaa
tgtactgtgatgggcataccaagtgtcaccaccaatctgtcagggtttggctgtttcatg
gaggagcatgtctcagaccctgctgcctatggtatctacatcgtggaccgtcggttcaga
tctgctgaggagtcctgcaaccagctgacccagttcatgctcagtttctgtcagcagtct
cgacgtcaacgcatcatccagaggaaccgaaccgagaggctgtcagacctgctggactgg
agatacttaggaaggttctacacacatgcccgtcatctggctcttagcagaagtttccca
gacaaatacaagatggataacaaaggccctctaaagactgagggtttccgttatcctcgg
ccagcttcagtgcctccgtctccctccgcctccctccattccaccccacaccacagtgat
gaggatgatgatgatgatgaaccatacaatgaagaagaggaggcagagagggaccggttg
aacatcaaggctccttttatgctgggatcagtgccagaaggcaagaaaaagcagccagga
gagtcagggaattaa

DBGET integrated database retrieval system