KEGG   Poecilia reticulata (guppy): 103459734
Entry
103459734         CDS       T05149                                 

Gene name
irs2
Definition
(RefSeq) insulin receptor substrate 2
  KO
K07187  insulin receptor substrate 2
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103459734 (irs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103459734 (irs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103459734 (irs2)
   04920 Adipocytokine signaling pathway
    103459734 (irs2)
Domain-containing proteins not elsewhere classified [BR:pret04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   103459734 (irs2)
SSDB
Motif
Pfam: IRS PH PH_11 PH_8 Mcp5_PH
Other DBs
NCBI-GeneID: 103459734
NCBI-ProteinID: XP_008399768
UniProt: A0A3P9QHR0
LinkDB
Position
LG2
AA seq 1110 aa
MASPPTTGGQALMTSTSNTNANNSAKKCGYLKKQKHGHKRFFVLKEPCEGFPARLEYYEN
EKKWRNKSAAKRVVPLDCCLNVSKRADAKHKYLIALYTKDEYFAVAAENEQEQENWYRAL
TDLMAEGKVCDGSASNSASSLVGFDETSYGVITPVAAAYKEVWQVNLKSRGLGQSRNLTG
VYRLCLSSRMISFVKLNSEVASVVLQLMNIRRCGHSDSFFFIEVGRSAAIGPGELWMQAD
DSVVAQNIHETILEAMKAMKELSEFRPRSKSQSSSTNPISVPTRRHLNNLPPSQTGLPRR
SRTDSTCATSPVSSKCLSCRIRTASEGDGTMTRPMSVTGSPLSPGVHRTILSRSHTVTAR
PSLTFESSTLQHSKSMSMPLSHSPPVATPCPGHVSNCVDSSVPRPSSCSASFSGSPSDAG
FISCEEYGSSPADARDLRLPLTLRSNTPESLKADTPPSRDGSELDGYMVMERQNQNGYRR
LSELDKVYRKRTYSLTTPRQQRRPPQVSSASLDEYTLMRATYTSGSRSSLRCHTASPKGS
GLEDYRDVHISSNSLHGDSGYMPMMPGVAPQTPGSKDDPYMPMSPMCVSAPKQIINPRSH
SCTAGLAPRTDSPGSISLEDNGYMPMWCGHKMSVESSDGKPSNGEYLYMSPVDALVSLTP
PEYLLSLSGDPHPHHRQPYCYSSLPRLVKGQLQRTGSADTDQYVVMSLQRQRIEEESNGG
PVSPGESGTGSSPGTPTTPSSLPSLKLTRSDGGMLHRSRVCRPTRLALESLRTLPCMSEH
PLPSEPRSPGEYINIDFGSSADVPLLESSEAGNVMCKEEGSLSLSDYANIDINSSVHLES
HQGEGSHPAGRLNHTSEVLMCSSMVSNQQDTQRVEGKEDEKRTEGETKTMGQKGSPVCEP
AITKSDYTEMTFGPSAPLSVLCTSDATPLPTSPTACVKRLSLESSLVDVVPPVPVDSFLL
GAPSLSLTVVDPDRGAKVIRADPQGRRRHSSETFSSTTTVTPVCPSFAHDTKRHSSASVE
NVSRSVHSSEEPGEDHSSPMCRETSAGYQNGLNYIALNLMEGNLGGGRLGACDEFLRFKT
TCGCKGGLNGFSASPYASLGFKETTTAVKE
NT seq 3333 nt   +upstreamnt  +downstreamnt
atggcgagtccgccaaccacgggcggtcaggcgctgatgaccagcactagtaatacaaac
gccaataacagcgcgaaaaaatgtggatacctgaagaagcagaaacacggacacaagcgt
tttttcgttttaaaggagccgtgtgaaggattccctgcccggctggagtactacgagaac
gagaagaaatggagaaacaagtccgcggctaagagagttgttcccctggactgctgcctc
aacgtcagcaagagagcggacgcgaaacacaagtatctcattgctctttacaccaaggac
gagtattttgccgtggcggcggaaaacgagcaggaacaggagaactggtaccgggcgctg
acggacctaatggccgaggggaaagtgtgtgacggctcggcgtccaactctgcgtcttca
ctggttggcttcgacgagacgagttacggtgtaataacgccggtggccgccgcctacaag
gaggtatggcaggttaacctcaaatccaggggactgggacagagtaggaatctgaccggt
gtgtacaggctctgtctctccagccgaatgatcagcttcgttaagctcaactcggaggtc
gcctctgtcgtactacagctgatgaacatccgaaggtgcggccattccgacagctttttc
ttcattgaggtgggtcgatctgcagccatcggtccaggggaactgtggatgcaagctgat
gactcagtagtggctcagaatatccacgaaactatcctagaggccatgaaagccatgaag
gagctgtcggagttccgcccgcgcagcaaaagtcagtcatctagcaccaaccccatctct
gtgccaacaaggaggcatctgaataatcttccaccgagccagaccggcctcccccggagg
tcccgtactgacagcacctgtgccacatctcctgtgagtagtaaatgcctgtcttgtcgt
atacgcacggccagcgagggcgatggcaccatgacacgcccaatgtctgtcaccgggagc
cccctcagcccaggggtccacaggaccatcctgagccggtctcacaccgtaacagcacgc
ccctccttgacttttgaatcttctactctccagcatagtaagtccatgtctatgcccctg
tctcattctccgcctgtggccaccccatgcccaggacatgtttccaactgtgtggacagc
agtgtcccccgcccctccagctgcagtgcatcattctcaggctctcccagtgatgcaggc
tttatatcatgtgaagaatatggctccagtcctgctgatgcacgggacctcaggttaccc
ctaacccttcgcagcaacactcctgaatctctgaaagcagacacccctccctccagggat
gggagtgaacttgatggctacatggtgatggagaggcaaaatcagaatggttaccggcgg
ctgtcagagctggataaagtgtatcgaaagcgaacatactccctcactaccccccgtcag
cagaggcgtccccctcaggtgtcctcagcttctctggatgaatacactctcatgagggcc
acatacaccagtggaagccggtcttctttgaggtgtcacacggcctcacctaaaggaagc
gggctagaagattacagggatgttcacatcagctctaacagtctccatggtgacagcggc
tacatgccaatgatgcccggagttgcaccccagactccagggtccaaggacgacccctac
atgcccatgagtcctatgtgtgtttctgctccaaagcagatcatcaatccacgttcacac
tcctgcaccgcagggttggccccacgcacagactcccctgggagtatttctctggaggac
aatggctacatgcctatgtggtgcggacacaagatgtcagtggaaagcagtgatggaaag
ccaagcaatggagagtacctgtacatgtctcccgttgatgctctggtttctctcacaccc
ccagagtaccttctcagcctctcaggagacccacacccccaccacagacagccttattgt
tacagctccctaccaagattagtcaaaggacagttgcagcgaactgggtctgctgacact
gaccagtatgttgtaatgagtttacagagacaacggatagaagaagagtcaaacggtggt
cccgtttcacctggagaatctggaaccggtagctccccaggtacgccaaccactccatct
tctctcccttctctaaaactgactcggtcagatggaggaatgttgcaccgcagcagggtg
tgccggcccacccgcctggctctggaatcccttcgaacactaccatgtatgagtgagcat
ccccttccctcagaacctcgcagccctggagagtacatcaacattgattttggtagttct
gccgacgtcccactgttggagagctcagaggctggaaacgtaatgtgtaaagaggaggga
tcactgtctctgtcagactatgctaacattgacatcaactcatcggttcatctcgaatca
caccaaggagaaggttcccacccagcagggcgtcttaaccatacatctgaagtcttgatg
tgctccagcatggtgagcaaccagcaggacacacagagagttgaagggaaggaggatgaa
aagagaacggagggagagacaaagacaatgggacagaaagggagtcctgtatgtgagcct
gctattaccaaaagtgactacactgagatgacctttggtccctctgctcctttatctgtt
ctctgcaccagtgatgccacccctctccccaccagccccactgcatgtgtgaagagactc
agccttgaaagcagcttagtggatgtggtgccccctgtgccagtggattctttcctactt
ggggcaccatcgttatctctcactgtcgtagatccagaccggggggccaaggttatccgg
gctgaccctcaggggcgtcgacgccatagctccgagaccttctcctccaccaccactgtg
acgcccgtgtgcccgtctttcgcccatgataccaagcggcacagctccgcttctgtggag
aacgtgtcccgctctgtccacagctccgaggagcccggcgaggaccacagcagccccatg
tgcagggaaacgtcagctgggtatcaaaacggactgaactacattgccttaaacttgatg
gaagggaacctcggcgggggcaggttaggcgcatgcgacgaattcctgagattcaagacg
acttgcggctgcaaagggggtctaaatgggttcagcgccagcccctacgccagcctggga
ttcaaggagactactactgctgtgaaagaatga

KEGG   Poecilia reticulata (guppy): 103474601
Entry
103474601         CDS       T05149                                 

Definition
(RefSeq) insulin receptor substrate 2-B-like
  KO
K07187  insulin receptor substrate 2
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103474601
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103474601
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103474601
   04920 Adipocytokine signaling pathway
    103474601
Domain-containing proteins not elsewhere classified [BR:pret04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   103474601
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 103474601
NCBI-ProteinID: XP_008423930
LinkDB
Position
LG2
AA seq 606 aa
MSEGHDSSTKRGFAEPPCTPRSSHHRSLTCAGESPLQFQLKNRHTEQDEEEDSNESPSSR
CFEELFCTKETPIPLAPLPCALMDASGPQGDVVKEGYLGKLERSHRRYFVLRTGSYTGPS
RLEWYKNQEKFTAMEKSVGKAALFGTSKQGVIYLRCCLGVSRSGSSRKGHMVVLYDKDQT
LVLVMEEQQQQEDWYLAIKRLVEDEQRDEEHEEGFDEDDDGYCTLPPAAFFKEVWPVMVK
PRGLGSSKLFTGENRLCLTASTLVMVRLGSSNDLPSVTIPLLSVRRFGHLDGFFFLELGR
SAPHGPGEIWMEAGEEGNPVLAQHIHESVRETVRSLRALPDFTRSLTSSPNQQPALLASK
RRRPKQRDKLANMRTLTPRVLHPRNSESQTSPAQHHRRAQTPEDTKSESSLSFTLHLSPA
RPQQNPAPETKSRTIQSWESAEKEEGFGYMMMSPTVSHSLSELPQDDYVVMESPQKLNWP
GYCSSSSSSSLQTSFSSSTCDSFSPLHPSRLQSSDISRQCCPGTPENVPSSMETSFSAQP
QQAQDFDRSFLIPPFLLSGSGTKKPPQSSPNADTSQFSRPQPEQEQVRRHWLTGCLFSCF
QTGEKS
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtcggaggggcatgatagttctaccaaaaggggatttgcagagcctccatgcacccct
cggtcatcacatcaccgcagcctcacttgtgcaggtgaatctcctttgcagtttcagctg
aagaatcgacacacagagcaggatgaagaggaggactcaaatgaatcgccttcatcccgc
tgctttgaggagctgttctgcactaaagagaccccaatacccctggcccccctaccctgt
gctttaatggacgcctcagggccgcaaggtgacgtggtgaaagaaggttacctggggaag
ctggagcggagccacaggagatatttcgtcctgcgaacgggaagttacaccggtccgagc
agactggagtggtacaagaaccaggagaagttcacggctatggagaagtctgttgggaag
gccgctctgtttggaaccagcaaacaaggggtcatttatcttcgttgctgtcttggtgtg
agtcggagtggcagttcccgaaaaggccacatggtggtgctgtacgacaaggatcagact
ctggtgctggtgatggaggagcagcagcaacaggaagattggtacctggccataaagagg
ctagtggaggatgagcagagggatgaggagcatgaagaagggttcgatgaagacgatgac
gggtactgcactctaccgcctgcagcgttcttcaaagaggtttggccggtcatggtgaag
cccagaggcctgggctcctccaaactgttcacgggggagaaccgtctctgcctcacagca
tcaacacttgttatggtccggctggggtccagtaatgacttgccatcagtcacgatacct
ttgctgagtgttcgccgctttggacacctggatggctttttctttttggagctgggcagg
tcggcgcctcatggtcccggagaaatctggatggaggctggagaagaaggaaacccagtt
ctggcccaacacatccacgagtcggttcgggagactgtgagatccctacgagctcttcca
gacttcaccagatctctgacatccagtcccaatcaacagccagcccttctggcctcaaag
cgccgccgacccaaacagagagacaagctggctaacatgagaactcttacacctcgggtt
cttcatcccagaaactctgagagccaaactagtcctgcacagcatcacagaagagctcaa
acaccagaagacacaaagtctgaatcctctctgagcttcaccttgcacctcagccctgct
agaccccagcagaacccggcgccggaaaccaaaagcagaacaattcagagctgggagtcg
gctgagaaggaggaaggatttggatacatgatgatgtccccgactgtcagccacagcctg
tctgagttacctcaggatgattacgttgtcatggagagtccacaaaaactcaactggcca
ggatactgctcctcttcatcgtcctcttcccttcagacgtcgttcagcagctccacctgt
gacagcttctctcctctgcatccttcacgccttcagagcagtgacatcagtcggcaatgc
tgcccggggactccagaaaacgtcccgtcgtcaatggaaaccagcttttctgcccagcca
cagcaggctcaggactttgatcggtctttcctgattcctccatttctgttgagtggctca
ggaacgaaaaagcctccacagtccagtccaaacgctgatacaagccagttcagtcgccct
caacctgaacaggagcaggtcagaagacactggctgacaggatgtcttttttcttgcttt
caaactggggagaaatcttga

KEGG   Poecilia reticulata (guppy): 103476518
Entry
103476518         CDS       T05149                                 

Definition
(RefSeq) insulin receptor substrate 2-like isoform X1
  KO
K07187  insulin receptor substrate 2
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103476518
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103476518
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103476518
   04920 Adipocytokine signaling pathway
    103476518
Domain-containing proteins not elsewhere classified [BR:pret04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   103476518
SSDB
Motif
Pfam: IRS PH PH_11 Mcp5_PH PH_8
Other DBs
NCBI-GeneID: 103476518
NCBI-ProteinID: XP_008427154
LinkDB
Position
LG2
AA seq 1061 aa
MASPPATGGHLLSNGTNDVKKCGYLRKQKHGHRRFFVLRESMERCPARLEYYESEKKWRN
KSAAKRVITLDSCLCVNKRADAKHKHLIALYTKDEYFAVAAENEQEQESWYTVLSDLIAE
SKVFDSPASTSSLVGFEETTYGQLTPATATYKEVWQVNLKSRGLGQIKNLTGVYRLCLSN
RNISFVKLNSETPAVNLQLMNIRRCGHSDSFFFIEVGRSAVTGPGEFWMQAEDSVVAQNI
HETILEAMKAMKELSEFRPRSKSQSASTNPISVPTRRNLNNLPPSQTGLVRRSRTDSMAA
TSPGRKFTSCRIRTASEGDGSVTRPVSMSIPVGESPTSPNSGYHLMRSHTLSNGRTCRIL
ESASNLHHSRSMPMSNSPPAASSPISSSPRGGTRVSTPDKARRPFSCSASISGSLSDTGF
LLCDDFSSSPGEHKFLTLTRSDTPDSLSSTPPSRDLSDPCGYMLMEGANGSRSSCGIESQ
NCDKAYRKRTHSLTTPRQQKVVTPLSSASLDEYTLMRMAHGQNSHSASPKVCYPEDYGDI
EIGSSRSSSSNLGDDGYMPMTPGVAPQSGKTDNYVPMSPMCVSAPKQIVNPRVHPQAATN
GYKANSPCSSSLEDSGYMRMWCGSKSSMDSPDRHGEYMNMSPGNPPPLQTPPDYYLSPLA
GEPASIKPAYQMGSLTLPAKLQSSKNEDSGQYVLMSPQSSRQKTGESDYYSVMQPCAVQT
SPLSPSVPSPVRHHRAENLSYRGRMGRPNRLSLDTLRTLPSMNEHPLPLEPRSPGEYINI
DFSSNRSSPPSTVSTESQSSSLGSSGGGQGRSSLSDYMNLELGSHSPKGADTPAERLDTL
PELSSCPCSEDDVVYHVECEKSSRSFVDEVKNDYTEMTFAMTSSPPQLVPQNSSSQSCRE
KRLSLDDQGVPERIGVFLLGAATSSTVDPDRSAKVIRANPQGRRRHSSETFSSTATVTPV
FPSFARGDAVKRPSSVENISSRSSEGSDEEYGSPVTRHSSTGYSNGLNYIALNLLENRDV
EKCGNLVGFKPTSSCKGGINGLHNTPYVCLGFKETATTAKD
NT seq 3186 nt   +upstreamnt  +downstreamnt
atggcaagtcctccggcgacgggaggacacctgttatctaatgggacgaatgacgtgaag
aagtgcggctacctgaggaagcagaaacacggacacaggcgtttttttgtgctccgggag
tccatggagcgctgtcccgcaaggctggagtattatgaaagcgagaagaaatggagaaat
aagtccgcagccaaacgcgtcataactttggactcctgtctgtgcgtaaacaaacgcgcc
gatgccaaacacaagcacctcatcgccctctacaccaaggacgaatactttgctgtggct
gcagaaaacgagcaggagcaggagagctggtacaccgttctgtctgatttaatagcagag
agcaaagtgtttgacagccctgcttccacatcctctttagtggggtttgaggagaccact
tacggacagcttacccctgcaacagctacctacaaggaggtgtggcaggtcaacttgaaa
tccagaggcttgggtcagatcaaaaacctcactggagtctacaggctgtgtttatccaac
cgaaacatcagcttcgtcaagctgaactctgagacaccagctgtcaacctccaactcatg
aacatcagaagatgtggccactccgacagcttcttcttcatagaggtgggcagatcagca
gtaaccgggccaggggagttctggatgcaagcagaggattcagtggtagcgcagaatatc
catgagaccatcctggaggcaatgaaggcgatgaaggagctctctgaattcaggccgagg
agcaaaagccagtcagccagcaccaaccccatctctgtgcccacccgacgcaacctcaac
aacctccccccaagtcagaccggcctggtgaggagatccagaaccgacagcatggctgcc
acatccccagggaggaagttcacctcctgtcggataaggacggccagtgagggagatgga
agcgtaacccggccagtgtccatgtccataccagtgggtgagagtcccaccagtcccaat
tctggatatcatctcatgaggtcccacacccttagcaatgggcgcacctgcaggatactg
gagtctgcatccaatctccatcacagtcgttcaatgccaatgtccaactctcctcctgcc
gcctccagcccaatcagctcatctcccaggggaggaacaagggtctccactccagacaaa
gccagacgtcctttcagctgcagcgcctccatatctggctccctcagcgatactggcttc
cttctctgtgatgatttcagctccagcccaggtgaacacaaatttctcactctgactcgc
agtgacactcctgactccctgtccagcacacctccatcccgtgacctgagcgacccctgc
ggctacatgctaatggagggggctaacggcagcaggtccagctgtgggatcgagagtcag
aattgtgacaaggcatacaggaagcgaacacactccctcaccacaccacgccaacagaag
gtggtgactccattgtcctctgcttccttggatgagtacactctaatgaggatggcccat
gggcaaaactctcactctgcttcacccaaagtatgctatcctgaggattatggggacatt
gaaattggttcatccaggagctccagtagcaaccttggcgatgatggttacatgcccatg
acgccaggtgtagcacctcagtctggcaagacggataactatgtacccatgagccccatg
tgtgtctcagcaccaaagcagattgtcaaccccagggtgcatccccaggcagctaccaat
ggctacaaggccaactctccctgtagcagctctctggaagacagcggatacatgagaatg
tggtgcggctccaaatcctccatggacagccctgacagacacggtgaatacatgaacatg
tcacctggaaacccaccccctctgcagacccctcctgattactacttaagccctctcgct
ggggaaccagcgtcaattaagccggcttaccagatgggctccctcacactgcctgcaaaa
cttcagtcatccaagaatgaagacagtggccagtatgtgttaatgagcccacagagttca
aggcagaagactggggagtcagactattattcagtaatgcaaccgtgtgcagttcaaaca
tcaccgctgagcccctcagtcccctccccagtcaggcatcatcgagcagagaatctgtcc
tacagagggaggatggggagacctaacaggctgtctctggacaccctgaggacccttccc
agcatgaatgagcatcccctgcccttagagccccgcagccccggcgagtacatcaacatc
gacttcagcagcaacagatcgtccccaccgtccaccgtatccacagagagccagtcttca
tctttggggtccagcggcgggggccaggggcggtcatctctgtcagactacatgaacctg
gagctgggctcacactcgcccaagggggctgacactccagctgagcgactggataccctg
cctgagctgtcctcatgcccctgctcagaggacgatgttgtgtaccatgtagagtgtgag
aaaagctcccgaagctttgtcgatgaggtgaaaaatgactatactgagatgacattcgca
atgactagctcacccccacagcttgttcctcagaactcaagcagccagagctgcagggag
aagaggctatctcttgatgaccaaggtgttcctgaacggattggggtcttcctgcttgga
gcagcaacttcctcaaccgtggacccagaccgctctgccaaggtcatccgggccaatcca
caagggcgaaggcgccacagttcagaaaccttctcctccacggccacagtgacgccggtc
tttccctcatttgcacgcggcgacgctgtgaaaaggccgagctcggtggagaacatctcg
tcccgcagcagtgagggttccgacgaggagtatggcagtcccgtgacccgccacagctcg
accggctactctaacggactgaactacatcgccttgaacctactagaaaacagggatgtg
gagaaatgtggaaacctggttggctttaaacccaccagcagctgcaaagggggcatcaat
ggattacacaacacaccttacgtctgtttggggttcaaggagactgcaaccactgccaaa
gactga

KEGG   Poecilia reticulata (guppy): 103480255
Entry
103480255         CDS       T05149                                 

Definition
(RefSeq) insulin receptor substrate 2-B-like
  KO
K07187  insulin receptor substrate 2
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103480255
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103480255
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103480255
   04920 Adipocytokine signaling pathway
    103480255
Domain-containing proteins not elsewhere classified [BR:pret04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   103480255
SSDB
Motif
Pfam: IRS PH_11 PH PH_8
Other DBs
NCBI-GeneID: 103480255
NCBI-ProteinID: XP_008433362
UniProt: A0A3P9NHH1
LinkDB
Position
LG18
AA seq 1360 aa
MANFTNYQEGKAAMLMVEPQQRDVGTSPAAAKANGDSSVGEPPSPLINIGGGGGGSRFHQ
HLPPPNHLHHHQNLSLDSPKDQQQHHHYQLAPQQHLSGENTTESPGRKASSSSSISQVHT
AEDPAASGSGSSHVYAAVTVANSSEVVDDIRKCGYLRKQKHGHKRFFVLRAASHLGPSRL
EYYDSEKKFRNSLRTAAAASGGAVAASPPKRVIYLYQCFTVNKRADSKNKHLIALYTKDE
YFAIVAENETEQEDWYVAISELMSEGKRGHVDSDDLDDGYGTVSPGTVFKEVWQVNVKPK
GLGQTKNLTGVYRLCLSTKTIHLVKLNSETPCVNLQLMNIRRCGHSESFFFIEVGRSSSI
GPGEIWMQVDDSVVAQNMHETILETMKALKAFAEFRPRSKSQSSGSNPMSFITTRRHLGN
LPPSQTGLQRRSRTESVVGTPPSSKSSGASGYRFRTSSEGEGTMNRPFRSATGSLVHLNA
ARVPHGRQDSGGSGSSWSGVATGNAGTSTTSNRYVRAIPSTCHARSASLPVSHFPSTTSP
VSVSSSSGHGSVSDTLTRPSSASICGSPSDGGFNSSDEYGSSPGDFRYFRVRSNTPDSLG
NTPPIREENCLNDYMAMGWNRDVFGTSVGSGNNSGCETPRDESTSTTEDERFSSSSLRRR
THSFSRAAAGVTGASGVATYQKMTQTNLSLDEGSDVVLPFGSGLLRGGPSSSSSSLRSDY
SSCSEHSQQSRPSTLSRSEAGAERPPLSSSSSAKEDSGYMPMMCGVAMASPRDTPPDYMP
MQPSSYSYQISHSPQFHSPALGTRSAHHHPQSSTDSHGYMMMLPGSSGTSPSPLQASSSG
PGAAGVGGSNSMAEKPENGEYMDMSYSGCGRKLPGEDSSVYYTPGTPEGPLKSYSPYFSL
PRSYKAPNREREEREDGEYVPMSSPAKPVYSSVATASMLVPEKRIGGGSNTSTPSHPPPP
YGAHHTTAAMADRRVMRPTRLPLGRRSFNGPLRVGEPATETPCATRSVPVTSVPREGPSS
PGEYINIEFGEHFPHQQQPPPYPLSTQDEAPSLVSSDACCSPPQDYMSVEVGSDQHDATA
CLGKNQSPRPSLVAPWNPPSYIRPLVNSSGVAGSGGHWRSVGDDYTDMSFNLSRGERTQS
PTAMLQHLCVVEGRYGHPASTTSSSTISPPHPPSTQQSEPKVVRADPQGRRRHSSETFSS
SSSSNSTPSSSATHPSLSNPSAPNANGSYQTEGQTSRWASSASFDSVWMSLAGAGDSPVH
HSQVRNAETDAMSGNIPTSASSGVGASRMCRNTSVGYQNGLNYIALELREDGSNAGAPGA
SSSSGNASVAPPGMVPLPENGAYASIDFTKSDGVTTATKD
NT seq 4083 nt   +upstreamnt  +downstreamnt
atggctaacttcacgaattaccaggagggtaaggcggctatgttgatggtggagcctcag
cagagggacgtggggacgagtcctgcggccgccaaagcaaacggagacagctcagtcggg
gaacccccttccccgttaattaatatcggcggcggcggaggaggctctcgttttcaccaa
catttgccgccccccaatcaccttcaccaccaccaaaacctcagcctcgactcgccaaag
gatcaacagcagcaccatcactaccagctggccccacagcagcatctttccggggaaaac
accaccgagtccccgggcagaaaagcctcctcctcctcttctatcagccaggtacacaca
gccgaggaccccgccgctagcggcagcggcagcagccatgtatacgccgctgtgaccgtc
gctaacagctcggaagtcgtggatgatattcgaaagtgcggttatttgagaaagcagaaa
cacggacacaagcggtttttcgtgctccgggctgccagccatctggggccgagtcgtctg
gaatactacgacagcgagaagaaattcagaaacagcctgcgcaccgctgccgccgctagc
ggaggagcggtggccgcttcgcctccgaagagggttatttacctctaccagtgtttcaca
gtgaacaaaagggcggactctaaaaacaaacacctcattgccctgtacaccaaggacgaa
tattttgctattgtggctgaaaacgagacggagcaggaggactggtatgtggccatcagt
gagttaatgagtgaggggaagagggggcacgtggactctgatgatttagatgatggctat
ggtacagtcagccctgggactgtgtttaaggaggtttggcaggttaatgttaaacctaaa
ggactgggtcaaactaaaaacctcacaggtgtttatcggctatgcctgtctactaaaacc
attcacctcgttaaactgaactctgaaaccccctgcgttaacctccagctgatgaacatc
aggcgctgtggacactctgagagcttcttcttcatagaggtgggccgctcctcctccatc
gggcctggggaaatatggatgcaggtggacgactcggtggtggcccagaacatgcacgag
accatcctggaaacaatgaaagccctgaaagcttttgcagaattccggccgaggagcaaa
agccaatcttcaggctccaaccccatgtcgttcatcaccacgcgacgccacctgggtaac
ctgcctccaagtcagacggggttgcagcggcggtcgaggacggagtctgtagtcggcacg
ccaccctctagtaaaagttccggggcgagcggctatcgcttccgcacatctagcgaaggt
gaggggacgatgaatcggccatttcgctctgccacgggaagcctggtccacctcaacgca
gcccgtgttccccatggccgtcaggacagcggcgggagtggcagcagctggagtggtgtt
gcaacaggaaatgctggcacgagcactaccagcaaccgctatgtcagagctatcccctcc
acctgtcacgcccgctcagcctcacttcccgtctcccacttcccttcgaccaccagccca
gtcagtgtttcctccagcagcggccatggctctgtttctgacacgctcacccgcccatca
agcgcctctatatgtggctccccatccgatggaggctttaactcctctgatgagtacggc
tccagtcccggtgacttccggtacttccgggtgaggagcaacacgccggattctctgggc
aacaccccaccaatcagagaggaaaactgcctcaacgattacatggccatgggctggaac
cgggacgttttcggcaccagtgtgggctctggaaacaacagtggatgtgagacaccacgt
gatgagagtacctcaacgaccgaggatgagcgcttttcttcctcatcactgaggaggagg
acgcactccttctccagagcagctgccggtgtgaccggagcctccggagtagctacttat
cagaaaatgacccagacgaacctctcgctggatgaggggtcagacgtagtgctgccattt
gggagcgggctgctccgtggtgggccgtcctcttcctcttcctcacttcgctccgactac
agctcatgctccgaacatagtcagcagagccgtccctcgacactctccaggtcggaggcc
ggagccgaacgcccccctctttcttcctcctcttctgccaaggaagacagcggctacatg
cccatgatgtgtggtgtggcaatggcgtcgccgcgggacactcctcctgactacatgcct
atgcaaccctcttcttactcctaccagatctcccactcaccccagttccacagcccagct
ctagggacgcgctcagcccaccatcacccacaatcttccacggactctcacggctacatg
atgatgctcccagggagcagtggcacctctccttctcctctccaggcctcttccagtggt
cctggagctgctggtgttggtggaagtaacagcatggctgagaaacctgaaaacggagaa
tatatggacatgtcctacagcggctgtggtcgcaagctcccaggtgaagacagcagtgtg
tattacacaccaggaacacccgaggggcccctgaagtcttacagtccttacttctctctc
ccccgctcttataaggcccccaacagggagagggaagagagagaggatggggaatacgta
cccatgagttcccctgccaaaccagtgtattcgtcagttgcaactgcttcaatgttggtg
ccagaaaaaagaataggagggggcagcaacacctccactccctcccacccacctcctccc
tatggagctcaccatacaactgcggcaatggctgaccgacgggtcatgagacctacccgc
cttcctttaggcaggaggagtttcaatggcccgctgcgggtcggcgagcccgccacagag
accccgtgtgctacaaggtctgtcccagtcaccagcgtcccacgcgaaggcccctcaagt
cccggagagtatatcaatattgagtttggagaacacttccctcaccaacagcagccccct
ccctatcccttgtccactcaagatgaagccccctccctggtatccagtgacgcttgctgc
tctcctccccaagactacatgagcgtggaggtcgggtcggaccagcatgatgccactgcg
tgtctgggtaagaaccagtcccccaggcccagccttgttgctccttggaacccgcccagc
tacatccgacctctggttaacagctctggggtcgccggttcaggcggtcactggaggtcg
gtaggagacgattacacggacatgtcattcaacctcagcagaggtgagaggactcaaagc
cccacagcgatgctgcagcatctttgcgtcgtagagggacgctatggtcaccctgcctcc
accacctcctcgtctaccatttccccacctcaccctccttcgacccaacagtcggagccc
aaggtggtgcgagcggacccccaaggcaggaggagacacagctcagaaacgttctcctcc
agctcatcctctaactcaacgccttcgtcctcagccacccatccgtctctgtccaacccc
tcggccccgaatgccaatggatcctaccagacggagggacagacctccaggtgggccagc
tcggcgtctttcgacagcgtgtggatgtccttggcgggcgcaggagactcgccagttcac
cactcccaggtgagaaatgcagaaactgacgccatgtccgggaacatcccaacgtccgcc
tcctcgggggttggcgccagcagaatgtgcaggaacacgtccgtcggctaccagaacggc
ctcaactacatcgccttggagctgagggaagatgggagcaacgcaggagcgccaggggcc
agtagcagcagcgggaatgcatcagtggcgccgccagggatggtacctctgccagagaat
ggagcctacgccagcatagacttcaccaaatcggatggagtcaccacagcaaccaaggac
tga

KEGG   Poecilia reticulata (guppy): 103480483
Entry
103480483         CDS       T05149                                 

Definition
(RefSeq) insulin receptor substrate 1-B-like
  KO
K16172  insulin receptor substrate 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103480483
   04150 mTOR signaling pathway
    103480483
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103480483
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103480483
   04920 Adipocytokine signaling pathway
    103480483
Domain-containing proteins not elsewhere classified [BR:pret04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   103480483
SSDB
Motif
Pfam: IRS PH PH_11 PH_8
Other DBs
NCBI-GeneID: 103480483
NCBI-ProteinID: XP_008433662
UniProt: A0A3P9P8R6
LinkDB
Position
LG18
AA seq 1274 aa
MEGQAGELHGNEDVRKSGYLRKQKSMHRRYFVLRAASERGPARLEYYESEKKFRGKAPVP
KKAVALETCFNINKRADSKNKHMIVLYTRAESFAVAAESEEDQDEWFQAMVELQCKSKNP
NDSASSGDYGAPNPGPAFKEVWQVKVWPKGLGQAKNLVGIYRLCLTDKTVNFVKLNSDAA
AVVLQLMNVRRCGHSENFFFVEVGRSAVTGPGEFWMQVDDSVVAQNMHETLLEAMKALSE
EFRQRTKSQSNSGPGGGATASNPISVPSRRHHPNPPPSQVGFLRRPRTEPTLGANVGAPL
GSSSASPTPRHSFPRSRTASDGGKSEDGIAGSNPLHSVNTSPSTNGSCSTTPILRSKSAR
SVPTTAAKTPFGLMRSISTPAPSPAPSLSSSSGHGSEFGGITSAGAVPGSGAYTRVASHH
TSVSCSPSDYGSSDEYGSSPGDHAVLPSPSLPGSSVSSTGSQCLGEDGANYILMGQRGGS
SGGVSNSNQGNMISSSQPVPGTPTNGSLPQTRRVLRRSSSRECEAERRLLSKRASLPPMA
LERLAPHQRRAEEPTDEDSADYAIMSRSTSRESFASTCSSIQRESTIGSCVGGGGYLDVA
GELKTDGGPGIVAGVDNGYMSMLPGVTQPPVSSCQTMTVSVPESDSKPADDYMAMTPNNS
VSPPQQIRPLPVSDGYMIMSPNSSCSPDQRGSLSEGAWVGSADSRAGSDYMNMSPISAPS
VNGSPPQNEHTCHLETSLQQPPPKMVYSYYSLPRSYKHNPTSGLFDDGPGRGRRPNGNCS
RGRGGGKNSGGHLEQPAGSSGTGRHQSLSSSSYSSSSASSESLGDNDDRTNQALGNVTTG
SQPKEVSKIAQRRSSGGLTKQGSHFRSRPVSLFVDVSKANTLPRVRENPLPPEPKSPGEY
VSIEFKGEQCSRSGVGVGRGRGLRHGSLLNHGSSHQHSQNRPTPSLETFIPLSHSPSAPV
SPPTPSEYVNMDLGPSPSPSPHSNTQLVFPPFHTPPTPPVLAHAPKTCTEGTASLCQGTV
EVAEPPLRKSRDSVPSVTETESPTSCGDYTEMAFSLNNNTAPRSSPRVSPKVPSPTRTDP
SVSVLSRGLDFPLGKSGLNPDQGAKVIRADPQGRRRHCSETFVATPSLSTSASTSSSTAS
LFPEHTQAVARRLGFESMLWGNGAVTDPPTQFPLPAQQSLPANNQTLSTEQGLNYIDLDL
VNKESPHTGLEGATGGQPQSRLFSVLGSGSVVGGMGATAGGSSSSSLNTYASIDFYKSEE
LRTHQNGNKEGTEC
NT seq 3825 nt   +upstreamnt  +downstreamnt
atggagggccaagcgggcgagctgcacggcaacgaggacgtgcgcaagagcggctacctc
cgcaagcagaagtccatgcaccggcgctacttcgtgctgcgcgccgcctcggagcgcggt
ccggcccgcctggagtactacgagagcgagaagaagttccgcggcaaggcccccgtgccg
aagaaggcggtggcgctggagacgtgcttcaacatcaacaagcgggccgactccaagaac
aagcacatgatcgtgctgtacacccgggcggagagcttcgccgtggccgcggagagcgag
gaggaccaggacgagtggttccaggccatggtggagctgcagtgcaaaagtaaaaatcct
aacgacagtgcgagttcaggggactatggcgcgccaaatccaggacctgcgttcaaagaa
gtttggcaggtgaaggtgtggcctaaaggcctgggtcaggccaagaacctggtgggcatc
tatcgcctctgccttaccgacaagacggtaaactttgtgaagctgaactccgacgcagcc
gctgtggtgctgcagctgatgaacgtcaggcgttgcggacattcggaaaactttttcttt
gtcgaggtgggacgctctgctgtgacgggccccggcgagttttggatgcaggtcgatgat
tctgtggtggcccagaacatgcatgaaaccttgctggaggccatgaaagccctgagtgag
gagtttcgccagcgcacaaagtctcagtcaaactctggtcctggaggaggcgccacagct
tccaatcctatcagtgttccttctcggcgccaccatcccaatccccctccaagccaggtg
ggcttcctccgccgtccccgaactgagcctaccttaggtgctaatgtgggagctccgtta
ggcagttccagtgcctctcccacgcctcggcacagcttcccgaggtcccgcactgccagc
gatggagggaaaagtgaagatgggatagcaggatccaatccgctccacagtgtaaacaca
agtccttctaccaatggctcctgctctaccaccccgatcctcaggtcaaagtcagcccgc
tcagtcccaaccacagctgctaaaactccttttgggttgatgcgttccatttcaactccg
gccccatcaccggccccaagtctgtcgtccagctctgggcacggatctgagtttggaggc
atcacatctgctggtgctgtcccagggtctggtgcttatactcgtgtagcctctcatcat
acctcagtctcgtgctcacccagtgattacggctcctcagatgagtatggttccagtcct
ggagatcacgcggttctaccctctccgagcctgccaggaagctctgtcagcagcactggc
agccagtgccttggcgaggatggagcgaactacatcctaatgggtcaacgaggtgggagc
agtggtggtgtcagcaacagtaatcaaggcaacatgatatccagctcccaacctgtacca
ggaacaccaactaatggctcactgccccagaccaggagagtattgcgtcgatcttctagc
cgtgaatgtgaggctgaacgcaggcttctgagcaagcgtgcatccttgcctcctatggcc
ctggaaagactggccccacaccagcgcagagctgaggaacctacggatgaagattcagct
gattatgccattatgtcaaggagcaccagtcgggagtcctttgcatctacctgctcatct
attcaaagggaatcaaccataggctcttgtgtagggggaggagggtacttggatgtagca
ggagagttaaaaactgatggtggtccaggaatagttgcaggtgtggacaatgggtacatg
tccatgctaccaggagtcacccagccgcctgtttcctcatgtcagacaatgactgtctct
gttccagaatcagattccaaacctgctgatgactacatggccatgacccccaacaatagc
gtgtctcccccgcagcagattcgtcccctgccagtgtctgacggctatatgataatgtca
cccaacagcagttgctcccctgaccagcgtggaagcctctctgaaggcgcttgggttggc
agtgccgatagcagagctggtagcgactacatgaacatgtctcccattagtgcaccttct
gtaaatggcagtccacctcaaaatgagcacacctgccatttggaaaccagtttgcaacag
ccgcccccaaagatggtgtattcctattattcccttcccagatcgtacaaacataatccc
acttctgggctttttgacgacgggcccggacgaggtagacgccccaatgggaactgtagc
agagggagaggtggcggcaaaaactcaggggggcatctagagcagccagcaggcagttca
gggactggacggcaccagtcactctcttcgtcctcatactcctccagctcagctagcagt
gagagtcttggagataacgatgacaggactaaccaggctctgggtaatgtgacaactggt
tctcagcccaaagaggtgagcaagattgctcagaggcggagctctggtgggttaacaaag
caaggtagccactttagaagcagaccagtaagcctatttgtagatgtatctaaggccaac
actcttcctagggtccgtgagaaccccttacccccagaacctaagagccctggagagtat
gtgagcattgaatttaaaggggagcagtgcagccggtctggtgtaggagttgggcgaggt
agaggcctgagacatggatcattgctgaatcatggctcaagtcaccagcattctcaaaac
agaccaactccatctctagaaaccttcattcccctgtctcatagtccctctgcccctgtc
tctccaccaactccatcagagtacgtcaacatggacctcggtccttcaccatccccttca
ccccattccaatacccagttagtttttccacctttccacacccctcccacacccccagtt
cttgctcatgcccctaaaacctgtacggaaggtactgctagtctgtgccaagggactgtt
gaagttgctgagccacctcttaggaaaagcagagacagtgttccctcagtgactgagaca
gagtctcctacatcctgtggagactacacagagatggctttcagcttgaacaacaacact
gcccctcggtcatcgccaagggtctccccaaaagtcccctctcctacaagaactgatcct
tctgtttcagtgctctctcggggtctagacttccctctaggcaaatcaggactgaaccca
gaccagggtgctaaagtaatccgtgctgatccccaaggacgcaggcgccactgctcagaa
acctttgtggccacaccctccctgtccacctctgcttctacttcttcttctactgcctcc
ctctttccagagcacacccaggccgtcgcccgccgcctcggctttgagagcatgttgtgg
gggaacggtgccgtcactgatcctccaactcaatttccactccctgcacagcagtcactt
cccgcaaacaatcagacattatccacggagcagggtctcaactacatagacttggacttg
gtcaacaaagagagtccccacactggcctggaaggcgccacaggaggccagccccaatct
cggctgttctctgttcttgggtcgggctccgtggttgggggaatgggggcaacagctgga
gggagcagcagttcaagcctcaacacatacgccagcatcgacttctacaaatccgaggag
ctacggacacatcagaacgggaacaaagagggaacagagtgctga

DBGET integrated database retrieval system