KEGG   Poecilia reticulata (guppy): 103459790
Entry
103459790         CDS       T05149                                 

Gene name
prkcq
Definition
(RefSeq) protein kinase C theta type isoform X1
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04140  Autophagy - animal
pret04270  Vascular smooth muscle contraction
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103459790 (prkcq)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103459790 (prkcq)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103459790 (prkcq)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103459790 (prkcq)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103459790 (prkcq)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103459790 (prkcq)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C1_2 Zf_RING zf-RING_9 PHD zf-RING-like Kinase-like APH DZR
Other DBs
NCBI-GeneID: 103459790
NCBI-ProteinID: XP_008399872
UniProt: A0A3P9PYZ7
LinkDB
Position
Unknown
AA seq 719 aa
MSPFLRIGFSSFEIDPGLAYYEEALNPYCAVYMKEAVDTEKGQVYKQKKPTMYPPWSSTF
DAHVHRGRIMHVMVKDRTAELRSEATVALDSLATRCKKENGKLEIWLEMKPQGRLLMEAR
YYLEKSDAAGQAGADPDSERGRDGLFTLHQRRGAIKQAKIHLVKCHEFSATFFPQPTFCS
VCKEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAVNSKETMIHKERFKIDMPHRF
KVYNYKSPTFCQHCGTLLWGLAKQGLKCEECSMNVHHKCQKKVANLCGVNQKLMAEALAV
IGSQQQARSTKDGDIMGREGPVGIGQPGVVRAPSGLVPGLPVTPAPASKDPTGVLWEGPT
EVSRPTPEAAQEEPLYAVPKKDHQQKFSIDDFVLHKMLGKGSFGKVFLAELKRSGKFFAV
KALKKDVVLMDDDVECTLVERRVLSLAWENPFLTHLYCTFQTKENLFFVMEYLNGGDLMF
HIQTCHKFDLHRATFYAAEIVCGLQFLHSKGIIYRDLKLDNVLLDSDGHIKIADFGMCKE
NMEDDLRTSTFCGTPDYIAPEILLGQKYNSSVDWWSFGVLLYEMLIGQSPFHGRDEEELF
QSIRTDSPVYPSWLTKMARDILVKLFVREPEERLGVKGSIRQHGFFSSTDWSALEQRQVA
PPFRPTLTSPSDCSNFDKEFINEKPKLSCADRTLINSVDQTMFRNFSFVNPGMARIAAR
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtctcctttcctgcggatcggcttctccagcttcgagatcgaccccggcttggcgtac
tacgaggaggcgctgaacccgtactgcgccgtctacatgaaggaggccgtggacacagag
aagggccaggtgtacaagcagaagaagcccaccatgtacccgccgtggagctccacgttc
gatgcccacgtccaccgcggccgcatcatgcacgtcatggtgaaggaccggacggccgag
ctgcggtccgaggccaccgtggcgctggactccctggccacgcgctgcaagaaggagaac
ggcaagctggagatctggctggagatgaagccgcagggccgcctgctgatggaggcccgg
tactacctggagaagagcgacgctgcgggtcaggccggcgccgacccggactcggagcgc
ggcagagacggcctgttcacgctgcatcagcggcgcggcgccatcaagcaggccaaaatt
cacctggtgaagtgtcacgagttcagcgccaccttcttccctcagcccaccttctgctcc
gtctgcaaggagttcgtctggggtctgaacaagcagggctaccagtgcagacaatgcaac
gctgccatccacaagaaatgcatcgacaaggtcatcgccaaatgcaccgggtcggcggtg
aacagcaaggagaccatgatccataaggagcgcttcaagatcgacatgccgcaccgcttc
aaggtgtacaactacaagagccccaccttctgccagcactgcggcaccctgctgtggggg
ctggccaagcaggggctgaaatgtgaggagtgcagcatgaacgttcaccataaatgccag
aagaaggtggcgaacctctgcggcgtcaaccagaagctgatggctgaagctctggccgtc
atcgggagccagcagcaggcgagaagtactaaagacggcgacatcatgggtcgagaaggt
ccggtgggcattggccagccgggcgtggttcgggcaccgtccgggttggtaccgggtctg
cccgtcacgccggcgcctgctagcaaagatccgacgggcgttttgtgggaagggccgacc
gaggtgagcaggccgaccccggaggcggcccaggaggagccgctgtacgccgtcccaaag
aaggaccatcagcagaagttcagcatcgacgacttcgtcctgcacaagatgctgggcaaa
ggaagcttcggaaaggtgtttctggccgagctgaagaggagcgggaagtttttcgctgtg
aaggctctgaagaaggacgtggtgctgatggacgacgacgtggagtgtacgctggtggag
aggagggttctgtctctggcctgggagaacccgttcctcacacacctgtactgcaccttc
cagaccaaggagaacctcttcttcgtgatggagtatctgaacggaggagatctcatgttc
cacatccagacctgccacaagttcgacctgcacagagccacgttctacgcagccgagatc
gtctgcggcctccagttcctgcactccaagggaatcatctacagagacctgaagctggac
aacgtcctgctggactcggatggacacataaagatcgccgacttcgggatgtgtaaggag
aacatggaggacgacctgcggacctcaaccttctgcgggacgccggactacatcgccccg
gagatcctgctgggccagaagtacaacagctcggtggactggtggtccttcggggttctg
ctctacgagatgctgatcggtcagtcgccgttccacggccgcgacgaggaggagctcttc
cagtccatccggaccgactcgcccgtctatcccagctggctcaccaagatggccagagac
attctggtcaagctgtttgtccgggagccggaggaacgactgggagtgaagggaagcatc
cggcagcacggcttcttcagcagcacggactggagcgccctggagcagcggcaggtggcg
ccgcccttcaggcccacgctgacgtcaccaagcgactgcagcaactttgacaaagagttc
atcaacgagaagccgaagctgtcgtgtgccgaccggacgctcatcaacagcgtggaccag
accatgttcaggaacttctccttcgtcaacccagggatggcccgcatcgccgcccgctga

DBGET integrated database retrieval system